Human Peptide YY (3-36)

Supplier: Anaspec Inc

AS-24405 AS-24406
102996-562EA 383.08 CAD
102996-562 102996-564
Human Peptide YY (3-36)
Proteins and Peptides

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR