Print…

You Searched For: 3,4-Methylenedioxycinnamic+acid


68,881  results were found

Refine Results Sort by
SearchResultCount:"68881"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-ABCA_AB314807-100U

Anti-Thrombopoietin Rabbit Monoclonal Antibody [clone: EPR27961-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR27961-34] to Thrombopoietin - BSA and Azide free (Detector).

New Product

Image Unavailable-TCT0095-100G

Tetraethylammonium chloride ≥98.0% (by titrimetric analysis)

Catalog Number: (TCT0095-100G)
Supplier: TCI America
Description: CAS Number: 56-34-8
MDL Number: MFCD00011828
Molecular Formula: C8H20ClN
Molecular Weight: 165.71
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White

SDS Certificates


Product Image-ABCA_AB126732-1ML

Anti-Amyloid Precursor Protein Rabbit Monoclonal Antibody [clone: EPR5118-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product

Product Image-ABCA_AB238916-100U

Anti-Amyloid Precursor Protein Rabbit Monoclonal Antibody [clone: EPR5118-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein - BSA and Azide free.

New Product

Image Unavailable-CA8.01847.0100

Butyl vinyl ether stabilized for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Cas Number 111-34-2, Stabilised With 100 Ppm Koh For Synthesis

SDS

Product Image-ABCA_AB256268-100U

Anti-CD1a Mouse Monoclonal Antibody [clone: NA1/34] (Alexa Fluor® 488)

Catalog Number: (ABCA_AB256268-100U)
Supplier: Abcam
Description: Alexa Fluor® 488 Mouse monoclonal [NA1/34] to CD1a.

New Product


Image Unavailable-TCB5140-1G

N,N'-Bis(4-methoxy-2-methylphenyl)-N,N'-diphenylbenzidine ≥98.0% (by HPLC, total nitrogen), purified by sublimation

Supplier: TCI America
Description: N,N'-Bis(4-Methoxy-2-Methylphenyl)-N,N'-Diphenylbenzidine (Purified By Sublimation), Purity: >98.0%(HPLC)(N), Cas no: 169685-34-1, Molecular formula : C40H36N2O2 /576.74, Size: 5G

Product Image-ABCA_AB95571-100UG

Anti-MHC class I Mouse Monoclonal Antibody [clone: 34-1-2S] (PE (Phycoerythrin))

Catalog Number: (ABCA_AB95571-100UG)
Supplier: Abcam
Description: PE Mouse monoclonal [34-1-2S] to MHC class I.

New Product


Product Image-ABCA_AB238446-100U

Anti-MEF2A+MEF2C Rabbit Monoclonal Antibody [clone: EPR19089-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR19089-34] to MEF2A + MEF2C - BSA and Azide free.

New Product

Image Unavailable-TCB0699-25ML

Diethylene glycol monobutyl ether ≥99.0%

Supplier: TCI America
Description: CAS Number: 112-34-5
MDL Number: MFCD00002881
Molecular Formula: C8H18O3
Molecular Weight: 162.23
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 230
Melting point (°C): -68
Flash Point (°C): 78
Specific Gravity (20/20): 0.96

SDS Certificates

Product Image-ABCA_AB181095-100U

Anti-Actin Regulatory Protein CAPG/MCP Rabbit Monoclonal Antibody [clone: EPR13194-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR13194-34] to Actin Regulatory Protein CAPG/MCP.

New Product

Image Unavailable-TCD4135-5G

4,6-Dichloro-2-(methylsulfonyl)pyrimidine ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 4489-34-3
MDL Number: MFCD00672147
Molecular Formula: C5H4Cl2N2O2S
Molecular Weight: 227.06
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 120

SDS Certificates

Product Image-77172-350

Anti-GABRA4 Mouse Monoclonal Antibody [clone: S398A-34]

Catalog Number: (77172-350)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S398A-34] antibody to GABRA4 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
Image Unavailable-ABCA_AB306412-100U

Anti-Amyloid Precursor Protein Rabbit Monoclonal Antibody [clone: EPR5118-34] (PE (Phycoerythrin))

Catalog Number: (ABCA_AB306412-100U)
Supplier: Abcam
Description: PE Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Product Image-80066-270

Gas Washing Bottle, Fritted, Tall Form, Chemglass

Supplier: Chemglass
Description: Tall form gas washing bottle having a standard taper 34/28 top joint.

Small Business Enterprise

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,185 - 1,200 of 68,881
no targeter for Bottom