You Searched For: 3,4-Dimethoxyaniline


5,297  results were found

SearchResultCount:"5297"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (77978-704)
Supplier: LGC Standards
Description: TRC Trans-3,4-Bis[[(methylsulfonyl)thio]methyl]-2,2,5,5-tetramethylpyrrolidin-1-yloxyl Radical

New Product


Catalog Number: (CA422905-BL)
Supplier: Biolegend
Description: Rainbow Fluorescent Particles, 1 peak (3.0-3.4 UM) - Mid Range Intensity ; Apps: FC


Catalog Number: (ABCA_AB312245-100U)
Supplier: Abcam
Description: Alexa Fluor® 555 Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Supplier: Abcam
Description: Rabbit monoclonal [EPR26423-34] to GPCR GPR17 - BSA and Azide free.

New Product

Supplier: Thermo Scientific Chemicals
Description: Alizarin complexone, (max. 10% H₂O)
Catalog Number: (75835-852)
Supplier: Restek
Description: Standard Pesticide mix Simazine, Cas number: 122-34-9, Concentration: 1,000 ug/mL in methanol, Minimum shelf life: 6 months, Volume: 1ml/ampule


Catalog Number: (CAAAAL01627-06)
Supplier: Thermo Scientific Chemicals
Description: 2-Chloro-4,5-xylenol 98%

Catalog Number: (ABCA_AB306414-100U)
Supplier: Abcam
Description: HRP Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Supplier: TCI America
Description: CAS Number: 73183-34-3
MDL Number: MFCD00799570
Molecular Formula: C12H24B2O4
Molecular Weight: 253.94
Purity/Analysis Method: >99.0% (GC)
Form: Crystal
Melting point (°C): 138
Supplier: VWR International
Description: Choose from four kits specifically designed to fit within laboratory fume hoods.

Product available on GSA Advantage®

Supplier: TCI America
Description: CAS Number: 21524-34-5
MDL Number: MFCD00051547
Molecular Formula: C15H23Br
Molecular Weight: 283.25
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 148
Flash Point (°C): 110
Specific Gravity (20/20): 1.13
Supplier: TCI America
Description: CAS Number: 271-34-1
MDL Number: MFCD00955936
Molecular Formula: C7H6N2
Molecular Weight: 118.14
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Color: White
Boiling point (°C): 132
Melting point (°C): 113
Lambda max.: 264 nm (H2O)

SDS

Supplier: TCI America
Description: CAS Number: 17094-34-7
MDL Number: MFCD00042886
Molecular Formula: C9H16O3
Molecular Weight: 172.22
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 88
Flash Point (°C): 78
Specific Gravity (20/20): 0.97
Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (ABCA_AB242008-100U)
Supplier: Abcam
Description: Mouse monoclonal [S398A-34] to GABRA4.

New Product


Catalog Number: (ABCA_AB310261-100U)
Supplier: Abcam
Description: Alexa Fluor® 647 Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
881 - 896 of 5,297
no targeter for Bottom