Print…

You Searched For: Tetraethylammonium+trifluoromethanesulphonate


10,141  results were found

Refine Results Sort by
SearchResultCount:"10141"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-H-9405.0005BA

(d(CH₂)₅¹,Tyr(Me)²,Thr⁴,Orn⁸,Tyr-NH₂⁹)-Vasotocin Trifluoroacetate

Supplier: Bachem Americas
Description: For atosiban see H-6722.

Image Unavailable-10772-618

Human Recombinant BMP-3 (from E. coli)

Supplier: Peprotech
Description: TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling and maintenance of a variety of other tissues and organs. BMP-3 is abundantly found in adult bone and, to a lesser extent, fetal cartilage. BMP-3 inhibits osteogenesis and bone formation by activating a signaling cascade that antagonizes the signaling of pro-osteogenic BMPs. Recombinant Human BMP-3 is a disulfide-linked homodimeric protein that corresponds to residues 361 to 472 of the 472 amino acid BMP-3 precursor protein. The calculated molecular weight of Recombinant Human BMP-3 is 25.2 kDa.

Image Unavailable-102998-448

Human Calcitonin Peptide

Catalog Number: (102998-448)
Supplier: Anaspec Inc
Description: Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-10772-476

Human;Mouse;Rat Recombinant GDF-11 (fromE. coli)

Supplier: Peprotech
Description: GDF-11 is a myostatin-homologous protein that acts as an inhibitor of nerve tissue growth. GDF-11 has been shown to suppress neurogenesis through a myostatin-like pathway, which involves the arrest of the progenitor cell cycle in the G1 phase. Similarities between myostatin and GDF-11, which are 90% identical in their amino acid sequence, suggest that the regulatory mechanisms responsible for maintaining proper tissue size during neural and muscular development might be the same. Recombinant Human/Murine/Rat GDF-11 is a 25.0 kDa disulfide-linked homodimer containing two 109 amino acid polypeptide chains. It is highly homologous to myostatin/GDF-8, sharing 90% amino acid sequence identity.

Image Unavailable-10771-754

Mouse Recombinant Noggin (from E. coli)

Supplier: Peprotech
Description: Noggin belongs to a group of diffusible proteins that bind to ligands of the TGF-β family, and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action was critical for proper formation of the head and other dorsal structures. Consequently, noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of noggin in mice results in prenatal death, and a recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. Recombinant Murine Noggin is a 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Image Unavailable-10774-798

Mouse Recombinant beta-NGF (from E. coli)

Supplier: Peprotech
Description: β-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. β-NGF is a potent neurotrophic factor that signals through its receptor β-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. β-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. The functional form of Recombinant Murine β-NGF is a non-covalently-linked homodimer of two 13.4 kDa, polypeptide monomers that each contain 120 amino acids and three disulfide bonds, which are required for biological activity.

Image Unavailable-103003-372

Human HNP-2 Peptide

Catalog Number: (103003-372)
Supplier: Anaspec Inc
Description: HNP-2 is a 29-residue peptide present in human neutrophils and is a member of the defensin family of antimicrobial peptides.
Sequence:CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
MW:3371 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10072-744

Human Recombinant PLGF 3 (from E. coli)

Catalog Number: (10072-744)
Supplier: Prosci
Description: PlGF-3 is an angiogenic factor that belongs to the cysteine-knot superfamily of growth factors. PlGF-3 is expressed exclusively in the placenta. It signals through the VEGFR-1/FLT1 receptor and stimulates endothelial cell proliferation and migration. PlGF-3 lacks heparin binding affinity. Recombinant human PlGF-3 is a 45.7 kDa disulfide-linked homodimeric protein of two 203 amino acid polypeptide chains.
Image Unavailable-10072-652

Human Recombinant BD2 (from E. coli)

Catalog Number: (10072-652)
Supplier: Prosci
Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, four human β-defensins have been identified; BD-1, BD-2, BD-3 and BD-4. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they are chemoattractant towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal sequence and, in the case of BD-1 (36 a.a.), a propeptide region. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. β-Defensins are 3-5 kDa peptides ranging in size from 33-47 amino acid residues. Recombinant Human BD-2 is a 4.3 kDa protein containing 41 amino acid residues.
Product Image-CAPI26128

Pierce™ PEGylated SPDP Crosslinkers, Thermo Scientific

Supplier: Thermo Scientific
Description: Thermo Scientific Pierce™ PEGn-SPDP is a multifunctional crosslinker for protein conjugation via amine-to-amine or amine-to-sulfhydryl crosslinks that contain a n-unit polyethylene glycol (PEG) group and a reducible (cleavable) disulfide bond.

Image Unavailable-10779-102

Human;Mouse;Rat Recombinant BMP-2 (from CHO cells)

Supplier: Peprotech
Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with an osteoconductive carrier such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 appears to play an important role in cardiac morphogenesis, and is expressed in a variety of other tissues, including lung, liver, spleen, prostate, ovary, and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains (monomers) linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human/Murine/Rat BMP-2 derived from

Image Unavailable-CA82022-870

Dithiothreitol (DTT, Cleland's reagent)

Catalog Number: (CA82022-870)
Supplier: G-Biosciences
Description: Protein Modification Agent-Reducing agent for cleaving disulfide bonds. Size: 5 grams.

SDS


Image Unavailable-102999-778

Human Biotin-Oxytocin, Biotin

Catalog Number: (102999-778)
Supplier: Anaspec Inc
Description: This is Oxytocin (OT) N-terminally labeled with Biotin. OT is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1234.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103005-328

RGD-4C

Catalog Number: (103005-328)
Supplier: Anaspec Inc
Description: This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10779-564

Human Recombinant IL-2 (from E. coli)

Supplier: Peprotech
Description: IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions that are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine-activated killer cells, monocytes, macrophages and oligodendrocytes. Recombinant Human IL-2 is a 15.5 kDa protein, containing 134 amino acid residues including one intrachain disulfide bond.

Certificates

Image Unavailable-10774-610

Rat Recombinant EGF (from E. coli)

Supplier: Peprotech
Description: EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Rat EGF is a 6.2 kDa globular protein containing 54 amino acid residues, including 3 intramolecular disulfide bonds.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
161 - 176 of 10,141
no targeter for Bottom