Print…

You Searched For: 2,6-Dichloro-3-pyridineboronic+acid


69,587  results were found

Refine Results Sort by
SearchResultCount:"69587"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-89138-212

4-Methylumbelliferyl phosphate disodium salt (4-MUP-Na2)

Supplier: Biotium
Description: is a fluorogenic phosphatase substrate that releases the blue fluorescent dye 4-methyl-7-hydroxycoumarin. MUP free acid and its salt are the most widely used fluorogenic substrates for alkaline phosphatase detection.

Image Unavailable-102996-422

Human Brain Natriuretic Peptide 32

Supplier: Anaspec Inc
Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-10779-720

Human Recombinant IL-19 (from E. coli)

Supplier: Peprotech
Description: IL-19 belongs to the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine, because it up-regulates IL-6 and TNF-α, and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution, IL-19 exists predominantly as a non-disulfide-linked dimer.

Image Unavailable-10118-478

8270 Calibration Mix #1 (19 components), Restek

Catalog Number: (10118-478)
Supplier: Restek
Description: Contains: Benzoic acid (65-85-0); 4-Chloro-3-methylphenol (59-50-7); 2-Chlorophenol (95-57-8); 2,4-Dichlorophenol (120-83-2); 2,6-Dichlorophenol (87-65-0); 2,4-Dimethylphenol (105-67-9); 4,6-Dinitro-2-methylphenol (Dinitro-o-cresol) (534-52-1); 2,4-Dinitrophenol (51-28-5); Dinoseb (88-85-7); 2-Methylphenol (o-cresol) (95-48-7); 3-Methylphenol (m-cresol) (108-39-4); 4-Methylphenol (p-cresol) (106-44-5); 2-Nitrophenol (88-75-5); 4-Nitrophenol (100-02-7); Pentachlorophenol (87-86-5); Phenol (108-95-2); 2,3,4,6-Tetrachlorophenol (58-90-2); 2,4,5-Trichlorophenol (95-95-4); 2,4,6-Trichlorophenol (88-06-2)

SDS


Product Image-10087-354

Anti-GALNS Rabbit Polyclonal Antibody

Catalog Number: (10087-354)
Supplier: Proteintech
Description: GALNS(N-acetylgalactosamine-6-sulfatase) is also named as chondroitinase and belongs to the sulfatase family. It is one of sulfatases required to degrade glycosaminoglycans (GAGs), keratan sulfate (KS) and chondroitin-6-sulfate (C6S) and the enzyme is a dimer derived from two 60 kDa polypeptides, each of which is processed to 40 kDa and 15 kDa polypeptide subunits linked by disulfide bonds. The deduced 522-residue protein is composed of a 26-amino acid N-terminal signal peptide and a mature polypeptide of 496 amino acid residues, including 2 potential asparagine-linked glycosylation sites. Defects in GALNS are the cause of mucopolysaccharidosis type 4A (MPS4A), also known as Morquio A syndrome.
Image Unavailable-CAPI88431

L-Lysine-2HCl, [¹³C₆], lyophilized powder for SILAC

Catalog Number: (CAPI88431)
Supplier: Thermo Scientific
Description: Thermo Scientific Heavy and Light Amino Acids are used to specifically analyze protein expression by mass spectrometry using stable isotope labeling with amino acids in cell culture (SILAC) quantification kits.

Certificates


Image Unavailable-10072-846

Human Recombinant IL20 (from E. coli)

Catalog Number: (10072-846)
Supplier: Prosci
Description: IL-20 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 is a hematopoietic growth factor capable of stimulating colony formation by CD34+ multipotential progenitors, but not by other progenitor cells. IL-20 signals through a receptor system composed of type I IL-20R-α and type II IL-20R-β. Over-expression of IL-20 in keratinocytes expressing both receptor subunits has been implicated in the induction of inflammatory skin disease. Recombinant human IL-20 is a 35.2 kDa homodimeric protein consisting of two 153 amino acid polypeptide chains.
Image Unavailable-10779-762

Human Recombinant IL-22 (from E. coli)

Supplier: Peprotech
Description: IL-22 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10Rβ/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant Human IL-22 is a 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains.

Certificates

Product Image-CAJT1266-5

Calcium acetate monohydrate 99.0-101.0%, powder, BAKER ANALYZED® ACS, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Powder. Lot analysis on label.

Certificates

Image Unavailable-10081-468

Anti-RPS3 Rabbit Polyclonal Antibody

Catalog Number: (10081-468)
Supplier: Proteintech
Description: 40S ribosomal protein S3 (RPS3), also named as SW-cl.26, is a 243 amino acid protein,which contains one KH type-2 domain and belongs to the ribosomal protein S3P family. RPS3 localizes in the cytoplasm. RPS3 is identified in a IGF2BP1-dependent mRNP granule complex, which contains untranslated mRNAs. RPS3 plays a role in repairing various DNA damage acting as a repair UV endonuclease. Nuclear accumulation of RPS3 results in an increase in DNA repair activity to some extent, thereby sustaining neuronal survival.
Image Unavailable-CAAAA14043-30

Butyl-4-hydroxybenzoate 99+%

Catalog Number: (CAAAA14043-30)
Supplier: Thermo Scientific Chemicals
Description: Butyl-4-hydroxybenzoate 99+%

Certificates


Image Unavailable-CA76634-486

Anti-TNF-alpha Mouse Monoclonal Antibody [clone: LL025]

Catalog Number: (CA76634-486)
Supplier: Diagnostic Biosystems
Description: This MAb recognizes human 17-26kDa protein, which is identified as cytokine TNF-α (Tumor Necrosis Factor-alpha). Monomeric human TNF-α is a 157 amino acid protein (non-glycosylated) with a reported molecular weight of 17 kDa and can be expressed as a free molecule, also TNF-α is generated as a precursor form called transmembrane TNF-α can be expressed as a cell surface type II polypeptide consisting of 233 amino acid residues molecular weight 26 kDa. TNF-α is an important cell-signaling component of the immune system. It is a protein secreted by LPS stimulated macrophages, and causes tumor necrosis when injected into tumor bearing mice. TNF-α is currently being evaluated in treatment of certain cancers and AIDS Related Complex.
Image Unavailable-10779-730

Human Recombinant IL-20 (from E. coli)

Supplier: Peprotech
Description: IL-20 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. IL-20 is a hematopoietic growth factor capable of stimulating colony formation by CD34+ multipotential progenitors, but not by other progenitor cells. IL-20 signals through a receptor system composed of type I IL-20Rα and type II IL-20Rβ. Over-expression of IL-20 in keratinocytes expressing both receptor subunits has been implicated in the induction of inflammatory skin disease. Recombinant Human IL-20 is a 35.2 kDa homodimeric protein consisting of two 153 amino acid polypeptide chains.

Image Unavailable-75791-394

Mouse Recombinant Siglec-3

Catalog Number: (75791-394)
Supplier: Prosci
Description: Mouse myeloid cell surface antigen CD33(CD33) is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. CD33 contains one Ig-like C2-type domain and one Ig-like V-type domain. CD33 is a putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. CD33 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, CD33 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia. CD33 is becoming increasingly important as a target of antibody-mediated therapy in acute myeloid leukaemia (AML).
Product Image-10092-972

Anti-PSMD14 Rabbit Polyclonal Antibody

Catalog Number: (10092-972)
Supplier: Proteintech
Description: The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence.
Image Unavailable-10093-968

Anti-RPS3 Mouse Monoclonal Antibody [clone: 2G7H4]

Catalog Number: (10093-968)
Supplier: Proteintech
Description: 40S ribosomal protein S3 (RPS3), also named as SW-cl.26, is a 243 amino acid protein,which contains one KH type-2 domain and belongs to the ribosomal protein S3P family. RPS3 localizes in the cytoplasm. RPS3 is identified in a IGF2BP1-dependent mRNP granule complex, which contains untranslated mRNAs. RPS3 plays a role in repairing various DNA damage acting as a repair UV endonuclease. Nuclear accumulation of RPS3 results in an increase in DNA repair activity to some extent, thereby sustaining neuronal survival.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
481 - 496 of 69,587
no targeter for Bottom