Print…

You Searched For: 2,3-Dimethylphenylboronic+acid


74,615  results were found

Refine Results Sort by
SearchResultCount:"74615"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCN0303-100MG

L(+)-Norleucine ≥99.0% (by titrimetric analysis)

Catalog Number: (TCN0303-100MG)
Supplier: TCI America
Description: CAS Number: 327-57-1
MDL Number: MFCD00064423
Molecular Formula: C6H13NO2
Molecular Weight: 131.18
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Specific rotation [a]20/D: 23 deg (C=5, 5mol/L HCl)

SDS Certificates


Image Unavailable-CAAAA14735-30

Diethyl suberate 99%

Supplier: Thermo Scientific Chemicals
Description: Diethyl suberate 99%

Certificates

Image Unavailable-CA4.80592.9200

Hydrochloric acid 10% (w/v), EMPROVE® EXPERT Ph. Eur., JP, NF, SAFC®

Supplier: EMD MILLIPORE – PCS CA EXCEP
Description: Elemental impurity specifications have been set considering ICH Q3D (Guideline for Elemental Impurities). Class 1-3 elements are not likely to be present above the ICH Q3D option 1 limit, unless specified and indicated.

SDS

Image Unavailable-CA10817-564

Anti-TYRP1 Mouse Monoclonal Antibody [clone: Ta99]

Catalog Number: (CA10817-564)
Supplier: Biolegend
Description: TYRP1 (MEL-5), Monoclonal Antibody, Clone: Ta99, Host: Mouse, Species: Human, Isotype: IGg2a, Immunogen: Ta99 was developed using a SK-MEL-23 Melanoma cell line. Synonym: CAS2; 5, 6-dihydroxyindole-2-carboxylic acid oxidase, Application: IHC, Size: 1ml
Product Image-10389-554

Anti-CYP24A1 Rabbit Polyclonal Antibody

Catalog Number: (10389-554)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-10389-572

Anti-CYP24A1 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10389-572)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-TCP1300-025G

α-Phenylcinnamic acid ≥98.0% (by titrimetric analysis)

Catalog Number: (TCP1300-025G)
Supplier: TCI America
Description: CAS Number: 91-48-5
MDL Number: MFCD00004252
Molecular Formula: C15H12O2
Molecular Weight: 224.26
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 175

SDS Certificates


Image Unavailable-TCH0703-5G

Methyl (R)-(-)-3-hydroxyisobutyrate ≥99.0%

Supplier: TCI America
Description: CAS Number: 72657-23-9
MDL Number: MFCD00063450
Molecular Formula: C5H10O3
Molecular Weight: 118.13
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 60
Flash Point (°C): 81
Specific Gravity (20/20): 1.07
Specific rotation [a]20/D: -22.5 deg (neat)

SDS Certificates

Image Unavailable-75790-008

Human Recombinant MAG (from Cells)

Catalog Number: (75790-008)
Supplier: Prosci
Description: Human Myelin-Associated Glycoprotein,also known as MAG, Siglec-4,is a cell membrane glycoprotein that is a member of the SIGLEC family of proteins.MAG contains 4 Ig-like C2-type domains and 1 Ig-like V-type domain.MAG is believed to be involved in myelination during nerve regeneration. it is a adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells and Preferentially binds to alpha-2,3-linked sialic acid.
Product Image-10089-388

Anti-CK23 Rabbit Polyclonal Antibody

Catalog Number: (10089-388)
Supplier: Proteintech
Description: Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9–K23, and the hair keratins Ha1–Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1–K8, and the hair keratins, Hb1–Hb6. KRT 23 belongs to type I keratins.
Product Image-10062-012

Anti-ZNF821 Rabbit Polyclonal Antibody

Catalog Number: (10062-012)
Supplier: Prosci
Description: The ZNF821 protein contains two C2H2 zinc finger motifs and a score-and-three (23)-amino acid peptide repeat (STPR) domain. The STPR domain of the encoded protein binds to double stranded DNA and may also contain a nuclear localization signal, suggesting that this protein interacts with chromosomal DNA. The exact function of ZNF821, however, remains unknown.
Image Unavailable-10072-812

Human Recombinant ICAM1 (from CHO cells)

Catalog Number: (10072-812)
Supplier: Prosci
Description: ICAMs are members of the Ig superfamily of calcium-independent transmembrane glycoproteins. ICAM-1 is a ligand for lymphocyte function-associated (LFA) and Mac-1 integrins and the major human rhinovirus receptor. The primary function of ICAM-1 is to provide adhesion between endothelial cells and leukocytes after stress or injury. The human ICAM-1 gene codes for a 505 amino acid transmembrane glycoprotein containing a 29 amino acid cytoplasmic domain, a 23 amino acid transmembrane domain, and a 453 amino acid extracellular domain. Recombinant human ICAM-1 is a 49.5 kDa glycoprotein comprising the extracellular domain (453 amino acid residues) of ICAM-1. Monomeric glycosylated ICAM-1 migrates at an apparent molecular weight of approximately 72.0-80.0 kDa by SDS-PAGE analysis under reducing conditions.
Image Unavailable-103006-368

Rat Brain Natriuretic Peptide 45

Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10096-778

Anti-UMPS Rabbit Polyclonal Antibody

Catalog Number: (10096-778)
Supplier: Proteintech
Description: UMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa.
Image Unavailable-10774-268

Human Recombinant BCMA (from E. coli)

Supplier: Peprotech
Description: BCMA, a member of the TNF receptor superfamily, binds to BAFF and APRIL. BCMA is expressed on mature B-cells and other B-cell lines, and plays an important role in B-cell development, function and regulation. BCMA also has the capability to activate NF-κB and JNK. The human BCMA gene codes for a 184 amino acid type I transmembrane protein, which contains a 54 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 107 amino acid cytoplasmic domain. Recombinant soluble Human BCMA is a 50 amino acid polypeptide (5.3 kDa) comprising the TNFR homologous region of the BCMA protein.

Image Unavailable-10389-566

Anti-CYP24A1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10389-566)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
625 - 640 of 74,615
no targeter for Bottom