You Searched For: 2,3-Dimethylphenylboronic+acid


74,615  results were found

SearchResultCount:"74615"

Sort Results

List View Easy View

Rate These Search Results

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 17AF (IL-17AF) is a heterodimer that is composed of the interleukin 17A (IL-17A) and interleukin 17F (IL-17F) members of the IL-17 family of cytokines. IL-17AF is produced by T helper 17 cells (Th17) following interleukin 23 (IL-23) stimulation.

Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (89419-420)
Supplier: Prosci
Description: Presenilin1 peptide is used for blocking the activity of presenilin1 antibody.


Catalog Number: (75794-312)
Supplier: Prosci
Description: Tryptophan 2,3-dioxygenase (TDO) is a heme-containing dioxygenase catalyzing the addition of molecular oxygen across the 2,3-double bond of the indole ring of tryptophan to form N-formylkynurenine (NFK). In Anopheles gambiae, TDO is the only enzyme able to catalyze the first and rate-limiting step in L-Trp catabolism through the kynurenine pathway. Tryptophan is an essential amino acid for protein synthesis and also the precursor for production of a number of neurotransmitters, such as serotonin and melatonin; in mosquitoes, the kynurenine pathway is essential for eye pigmentation. Conceivably, the tryptophan-using pathways should be regulated in a coordinated manner in mosquitoes as well as in other species and TDO activation/inactivation processes could play an essential role in these phenomena.


Catalog Number: (89419-394)
Supplier: Prosci
Description: BRSK2 peptide is used for blocking the activity of BRSK2 antibody.


Catalog Number: (10096-778)
Supplier: Proteintech
Description: UMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa.


Catalog Number: (10389-574)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Catalog Number: (10389-568)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Catalog Number: (TCN0303-100MG)
Supplier: TCI America
Description: CAS Number: 327-57-1
MDL Number: MFCD00064423
Molecular Formula: C6H13NO2
Molecular Weight: 131.18
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Specific rotation [a]20/D: 23 deg (C=5, 5mol/L HCl)

Supplier: Thermo Scientific Chemicals
Description: 4-Hydroxybenzhydrazide 98%
Catalog Number: (10389-554)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Catalog Number: (10389-572)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.


Supplier: TCI America
Description: CAS Number: 72657-23-9
MDL Number: MFCD00063450
Molecular Formula: C5H10O3
Molecular Weight: 118.13
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 60
Flash Point (°C): 81
Specific Gravity (20/20): 1.07
Specific rotation [a]20/D: -22.5 deg (neat)
Catalog Number: (TCT2594-25G)
Supplier: TCI America
Description: CAS Number: 55525-27-4
Molecular Formula: C11H16O8
Molecular Weight: 276.24
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Very Pale Yellow
Boiling point (°C): 150
Specific Gravity (20/20): 1.24

Catalog Number: (10072-812)
Supplier: Prosci
Description: ICAMs are members of the Ig superfamily of calcium-independent transmembrane glycoproteins. ICAM-1 is a ligand for lymphocyte function-associated (LFA) and Mac-1 integrins and the major human rhinovirus receptor. The primary function of ICAM-1 is to provide adhesion between endothelial cells and leukocytes after stress or injury. The human ICAM-1 gene codes for a 505 amino acid transmembrane glycoprotein containing a 29 amino acid cytoplasmic domain, a 23 amino acid transmembrane domain, and a 453 amino acid extracellular domain. Recombinant human ICAM-1 is a 49.5 kDa glycoprotein comprising the extracellular domain (453 amino acid residues) of ICAM-1. Monomeric glycosylated ICAM-1 migrates at an apparent molecular weight of approximately 72.0-80.0 kDa by SDS-PAGE analysis under reducing conditions.


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00064209
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
625 - 640 of 74,615
no targeter for Bottom