Print…

You Searched For: 2,2\'-Dithienyl+disulfide


10,084  results were found

Refine Results Sort by
SearchResultCount:"10084"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10778-880

Human Recombinant TGF-alpha (from E. coli)

Supplier: Peprotech
Description: TGF-α is an EGF-related polypeptide growth factor that signals through the EGF receptor, and stimulates the proliferation of a wide range of epidermal and epithelial cells. It is produced by monocytes, keratinocytes, and various tumor cells. TGF-α induces anchorage-independent transformation in cultured cells. Human, murine and rat TGF-α are cross-species reactive. Recombinant Human TGF-α is a 50 amino acid polypeptide (5.5 kDa), which shares approximately 40% sequence homology with EGF, including 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds.

Image Unavailable-CAPIPA5-12630

Anti-MET Rabbit Polyclonal Antibody

Catalog Number: (CAPIPA5-12630)
Supplier: Thermo Scientific
Description: The proto-oncogene MET product is the hepatocyte growth factor receptor and encodes tyrosine-kinase activity. The primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor. Various mutations in the MET gene are associated with papillary renal carcinoma.
Product Image-CAPI20665

DTBP (Dimethyl 3,3′-dithiopropionimidate dihydrochloride), Pierce™

Catalog Number: (CAPI20665)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce DTBP is dimethyl 3,3'-dithiobispropionimidate, a crosslinker that contains amine-reactive imidoester groups around an 8-atom spacer arm, whose central disulfide bond can be cleaved with reducing agents.

SDS Certificates


Product Image-10782-620

Anti-rh GDNF Sheep Polyclonal Antibody

Catalog Number: (10782-620)
Supplier: Biosensis
Description: GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Image Unavailable-10781-366

Human Recombinant Galectin-3 (from E. coli)

Supplier: Peprotech
Description: Lectins, of either plant or animal origin, are carbohydrate-binding proteins that interact with glycoproteins and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 is normally expressed in epithelia of a variety of tissues, including colon and endometrium, and in various inflammatory cells, including macrophages. Galectin-3 can function intracellularly, controlling the cell cycle and preventing T-cell apoptosis, and also extracellularly, by activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes. Expression of Galectin-3 is affected by neoplastic transformation, being up-regulated in certain types of lymphomas, and in thyroid and hepatic carcinomas. Conversely, it is down-regulated in other cancers such as colon, breast, ovarian, and uterine. Recombinant Human Galectin-3 is a globular 26.0 kDa protein containing 250 amino acid residues, but no disulfide bonds.

Image Unavailable-89360-516

Anti-C Mouse Monoclonal Antibody [clone: HLW-C]

Catalog Number: (89360-516)
Supplier: Genetex
Description: Protein C is a vitamin K-dependent serine protease zymogen. Purified human activated protein C selectively destroys factors Va and VIII:C in human plasma and thus has an important anticoagulant role. Protein C deficiency has been associated with inherited thrombophilia. In its primary structure, protein C is similar to the prothrombin group of blood coagulation factors. It most closely resembles factor X and has light and heavy polypeptide chains linked by disulfide bridges.
Image Unavailable-10072-748

Human Recombinant Myostatin (from E. coli)

Catalog Number: (10072-748)
Supplier: Prosci
Description: Myostatin is a TGF-beta family member that acts as an inhibitor of skeletal muscle growth. This muscle-specific cytokine interacts with Activin type I and type II receptors, and suppresses myoblast proliferation by arresting cell-cycle in the G1 phase. Suppression of myostatin activity facilitates muscle formation and may be useful in reducing and/or preventing adiposity and type-2 diabetes. Myostatin activity can be blocked by the Activin-binding protein Follistatin, and by the propeptide of Myostatin. Recombinant Human myostatin is a 25.0 kDa protein consisting of two identical 109 amino acid polypeptides linked by a single disulfide bond.
Image Unavailable-103003-154

Human Adrenomedullin (1-52)

Catalog Number: (103003-154)
Supplier: Anaspec Inc
Description: Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-10772-512

Human;Mouse;Rat Recombinant Activin A (from (BTI-Tn-5B1-4) Hi-5 Insect cells)

Supplier: Peprotech
Description: Activin A is a TGF-β family member that exhibits a wide range of biological activities, including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin. Activin A binds to the two forms of activin receptor type I (Act RI-A and Act RI-B) and two forms of activin receptor type II (Act RII-A and Act RII-B). Activins are homodimers or heterodimers of different β subunits. They are produced as precursor proteins with an amino terminal propeptide that is cleaved to release the C-terminal bioactive ligand. Recombinant Human/Murine/Rat Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues.

Certificates

Image Unavailable-H-4928.0005BA

(d(CH₂)₅¹,Tyr(Me)²,Orn⁸)-Oxytocin Trifluoroacetate

Supplier: Bachem Americas
Description: For atosiban see H-6722.

Image Unavailable-10092-856

Anti-PRSS8 Rabbit Polyclonal Antibody

Catalog Number: (10092-856)
Supplier: Proteintech
Description: PRSS8(protease, serine, 8) displays trypsin-like enzymatic activities by hydrolyzing peptidyl fluorogenic substrates such as D-Pro-Phe-Arg-AMC. This trypsinlike enzymatic activity can be inhibited by aprotinin, antipain, leupeptin, and benzamidine. It is a heterodimer of two chains, light and heavy, which are held by a disulfide bond. PRSS8 is also named as CAP1 and belongs to the peptidase S1 family.
Image Unavailable-10072-676

Human Recombinant PDGF-CC (from E. coli)

Catalog Number: (10072-676)
Supplier: Prosci
Description: The platelet-derived growth factor (PDGF) family of heparin-binding growth factors consists of five known members, denoted PDGF-AA, PDGF-BB, PDGF-AB, PDGF-CC and PDGF-DD. The mature and active form of these proteins, an anti-parallel disulfide-linked dimer of two 12-14 kDa polypeptide chains, is obtained through proteolytic processing of biologically inactive precursor proteins, which contain an N-terminal CUB domain and a PDGF/VEGF homologous domain. The PDGFs interact with two related protein tyrosine kinase receptors, PDGFR-α and PDGFR-β, and are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and certain tumor cells. They play an important role in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubules epithelial cell development. Mature PDGFs are stored in platelet α-granules and are released upon platelet activation. PDGF-AA, -AB, -BB and -CC signal primarily through the PDGF-Rα receptor, whereas PDGF-DD interacts almost exclusively with the PDGF-Rβ receptor. Recombinant human PDGF-CC is a 25kDa protein consisting of two identical disulfide-linked 114 amino-acid polypeptide chains.
Image Unavailable-89351-270

Anti-VEGF Mouse Monoclonal Antibody [clone: 14-124]

Catalog Number: (89351-270)
Supplier: Genetex
Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.
Image Unavailable-103008-584

Bactenecin 2A

Catalog Number: (103008-584)
Supplier: Anaspec Inc
Description: This peptide is Bac2A, a linear variant of the loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils. The Cys disulfide bond-forming residues of Bactenecin is replaced with Ala in Bac2A, and is active against both gram-positive and gram-negative bacteria.
Sequence:RLARIVVIRVAR-NH2
MW:1420.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-H-6458.1000BA

Human Cortistatin-29 Trifluoroacetate

Supplier: Bachem Americas
Description: See also the product families 'Adjuvant Peptides' and 'Thymosins and Fragments'.

Image Unavailable-103004-134

Leiurus quinquestriatus hebraeus Charybdotoxin

Catalog Number: (103004-134)
Supplier: Anaspec Inc
Description: Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.
Sequence:Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
MW:4296 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
641 - 656 of 10,084
no targeter for Bottom