Print…

You Searched For: 2,2\'-Dithienyl+disulfide


10,602  results were found

Refine Results Sort by
SearchResultCount:"10602"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-75788-764

Human Recombinant EGF (from E. coli)

Catalog Number: (75788-764)
Supplier: Prosci
Description: Epidermal growth factor (EGF) is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites. EGF is a small 53 amino acid residue long protein that contains three disulfide bridges
Product Image-10103-122

Anti-KRTAP24-1 Rabbit Polyclonal Antibody

Catalog Number: (10103-122)
Supplier: Prosci
Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Image Unavailable-75790-336

Human Recombinant BPI (from Cells)

Catalog Number: (75790-336)
Supplier: Prosci
Description: Bactericidal permeability-increasing protein(BPI for short), is a secreted protein which belongs to the BPI/LBP/Plunc superfamily, BPI/LBP family. It exists as a monomer or a disulfide-linked homodimer. The cytotoxic action of BPI is limited to many species of Gram-negative bacteria. This specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. BPI has antibacterial activity against the Gram-nagative bacterium P.aeruginosa, and this activity is inhibited by LPS from P.aeruginosa.
Image Unavailable-103008-252

CKS-17 (dimer)

Catalog Number: (103008-252)
Supplier: Anaspec Inc
Description: A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-10092-856

Anti-PRSS8 Rabbit Polyclonal Antibody

Catalog Number: (10092-856)
Supplier: Proteintech
Description: PRSS8(protease, serine, 8) displays trypsin-like enzymatic activities by hydrolyzing peptidyl fluorogenic substrates such as D-Pro-Phe-Arg-AMC. This trypsinlike enzymatic activity can be inhibited by aprotinin, antipain, leupeptin, and benzamidine. It is a heterodimer of two chains, light and heavy, which are held by a disulfide bond. PRSS8 is also named as CAP1 and belongs to the peptidase S1 family.
Image Unavailable-89351-270

Anti-VEGF Mouse Monoclonal Antibody [clone: 14-124]

Catalog Number: (89351-270)
Supplier: Genetex
Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.
Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Product Image-89351-630

Anti-VEGF Mouse Monoclonal Antibody [clone: VG1]

Catalog Number: (89351-630)
Supplier: Genetex
Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.
Image Unavailable-H-2358.0500BA

Stichodactyla Helianthus Neurotoxin (ShK) Trifluoroacetate

Supplier: Bachem Americas
Description: These monosubstituted analogs of ShK toxin, a class of K channel blocking peptide toxins derived from the sea anemone Stichodactyla helianthus, were prepared in order to identify functionally important residues. Hereby it has been shown that the location of Lys²² within a helical structure represents a unique difference between the interactive surfaces of the sea anemone and scorpion toxins.

Image Unavailable-103003-360

Rat alpha-Calcitonin Gene Related Peptide

Catalog Number: (103003-360)
Supplier: Anaspec Inc
Description: α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10782-620

Anti-rh GDNF Sheep Polyclonal Antibody

Catalog Number: (10782-620)
Supplier: Biosensis
Description: GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Image-10782-408

Anti-native DBH Rabbit Polyclonal Antibody

Catalog Number: (10782-408)
Supplier: Biosensis
Description: DBH is an oxireductase belonging to the copper type II ascorbate-dependent monooxygenase family. DBH exists as a homotetramer composed of two non-covalently bound disulfide-linked dimers. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It binds 2 copper ions and 1 PQQ per subunit . Depending on the presence of a signal peptide, DBH can exist in both soluble and membrane-bound forms.
Image Unavailable-H-1482.0500BA

Human;Mouse;Rat MCH Trifluoroacetate

Supplier: Bachem Americas
Description: Melanin-concentrating hormone (MCH), originally isolated from salmon pituitary glands, has also been found in the mammalian CNS. In lower vertebrates, salmon MCH alters pigmentation by inducing melanosome aggregation within melanocytes of teleost fish, whereas it causes melanosome dispersion in amphibians and reptiles. The biological role of MCH in higher vertebrates, however, is not yet fully understood, but it may function as a neuromodulator and hypophysiotropic agent in the secretion of α-MSH, ACTH, and GH.

Image Unavailable-76303-944

Human Recombinant sCD8alpha (from CHO Cells)

Supplier: Peprotech
Description: Cluster of differentiation 8 (CD8), a type I transmembrane glycoprotein of the immunoglobulin family of receptors, plays an integral role in signal transduction, and T cell differentiation and activation. CD8 is predominantly expressed on T cells as a disulfide-linked heterodimer of CD8alpha and CD8beta, where it functions as a co-receptor, along with T cell receptor (TCR), for major histocompatibilty complex class I (MHC-I) molecules; whereas its counterpart, CD4, acts as a co-receptor for MHC-II molecules. CD8 exists on the cell surface, where the CD8alpha chain is essential for binding to MHC-I. CD8 is also expressed on a subset of T cells, NK cells, monocytes and dendritic cells as disulfide-linked homodimers of CD8alpha. Ligation of MHC-I/peptide complexes presented by antigen-presenting cells (APCs), triggers the recruitment of lymphocyte-specific protein tyrosine kinase (Lck), which leads to lymphokine production, motility and cytotoxic T lymphocyte (CTL) activation. Once activated, CTLs play a crucial role in the clearance of pathogens and tumor cells. Differentiation of naive CD8+ T cells into CTLs is strongly enhanced by IL-2, IL-12 and TGF-beta1. PeproTech's CHO cell-derived Recombinant Human sCD8alpha is a monomeric glycoprotein of 161 amino acid residues, which corresponds to the extracellular domain of CD8alpha. Peprotech's CHO cell-derived Recombinant Human sCD8alpha has a calculated molecular weight of 17.6 kDa; however, due to glycosylation, it migrates at an apparent molecular weight of approximately 27-29 kDa by SDS-PAGE analysis, under reducing conditions.

Product Image-CAPIPG82089

TCEP-HCl (Tris(2-carboxyethyl)phosphine hydrochloride), powder, Premium Grade, Pierce™

Supplier: Thermo Scientific
Description: Thermo Scientific Pierce Premium Grade TCEP-HCl is our highest quality formulation of this disulfide reducing agent, specially characterized for applications where product integrity and risk minimization are paramount.

SDS Certificates

Image Unavailable-H-9025.0500BA

Human;Mouse;Rabbit;Rat Endothelin-3 Acetate

Catalog Number: (H-9025.0500BA)
Supplier: Bachem Americas
Description: Endothelins are peptides with exceptional vasoconstrictor potency. They play an important role in intercellular communications.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
641 - 656 of 10,602
no targeter for Bottom