Print…

You Searched For: (S)-2,3-Diaminopropanoic+acid+hydrochloride


71,531  results were found

Refine Results Sort by
SearchResultCount:"71531"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAJ63982-K2

Safflower oil

Supplier: Thermo Scientific Chemicals
Description: Oil

Certificates

Image Unavailable-TCD1387-025G

(-)-Di-p-toluoyl-L-tartaric acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 32634-66-5
MDL Number: MFCD00064440
Molecular Formula: C20H18O8
Molecular Weight: 386.36
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 172
Specific rotation [a]20/D: -139 deg (C=1, EtOH)

SDS Certificates

Image Unavailable-TCT0005-500G

Dibutyl-L-(+)-tartrate ≥98% (by GC)

Supplier: TCI America
Description: CAS Number: 87-92-3
MDL Number: MFCD00009443
Molecular Formula: C12H22O6
Molecular Weight: 262.30
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Colorless
Flash Point (°C): 160
Specific Gravity (20/20): 1.09
Specific rotation [a]20/D: 13 deg (neat)

SDS Certificates

Image Unavailable-TCD1417-025G

(+)-Di-p-toluoyl-D-tartaric acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 32634-68-7
MDL Number: MFCD00008552
Molecular Formula: C20H18O8
Molecular Weight: 386.36
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 171
Specific rotation [a]20/D: 139 deg (C=1, EtOH)

SDS

Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-10773-122

Mouse Recombinant SCF (from E. coli)

Supplier: Peprotech
Description: SCF is a hematopoietic growth factor that exerts its activity by signaling through the c-Kit receptor. SCF and c-Kit are essential for the survival, proliferation and differentiation of hematopoietic cells committed to the melanocyte and germ cell lineages. Human SCF manifests low activity on murine cells, while murine and rat SCF are fully active on human cells. The human SCF gene encodes for a 273 amino acid transmembrane protein, which contains a 25 amino acid N-terminal signal sequence, a 189 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 36 amino acid cytoplasmic domain. The secreted soluble form of SCF is generated by proteolytic processing of the membrane anchored precursor. Recombinant Murine SCF is an 18.3 kDa polypeptide containing 165 amino acid residues, which corresponds to the sequence of the secreted soluble form of SCF.

Certificates

Image Unavailable-76085-302

Anti-CYP24A1 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76085-302)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-76085-300

Anti-CYP24A1 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76085-300)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-89411-164

Lucifer yellow CH dilithium salt 100 mM in water fluorescent dye

Catalog Number: (89411-164)
Supplier: Biotium
Description: Lucifer Yellow CH lithium salt (LY CH lithium salt) is a widely used polar molecular tracer for studying neuronal morphology. The fluorescent molecule contains a carbohydrazide that allow the molecule to be aldehyde-fixable. The lithium salt form of Lucifer Yellow is in an aqueous solution format that is ready for microinjection.
Image Unavailable-10777-994

Human Recombinant KGF (from E. coli)

Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF (FGF-7) signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Image Unavailable-10779-494

Human Recombinant ICAM-1 (from CHO cells)

Supplier: Peprotech
Description: ICAMs are members of the Ig superfamily of calcium-independent transmembrane glycoproteins. ICAM-1 is a ligand for the lymphocyte function-associated antigen (LFA) and Mac-1 integrins, as well as the major human rhinovirus receptor. The primary function of ICAM-1 is to provide adhesion between endothelial cells and leukocytes after stress or injury. The human ICAM-1 gene codes for a 505 amino acid transmembrane glycoprotein containing a 29 amino acid cytoplasmic domain, a 23 amino acid transmembrane domain, and a 453 amino acid extracellular domain. Recombinant Human ICAM-1 is a 49.5 kDa glycoprotein comprising the extracellular domain (453 amino acid residues) of ICAM-1. Monomeric glycosylated ICAM-1 migrates at an apparent molecular weight of approximately 72.0-80.0 kDa by SDS-PAGE analysis under reducing conditions.

Image Unavailable-CAAA39423-A1

Calcium stearate

Supplier: Thermo Scientific Chemicals
Description: Waterproofing and release agent, stabilizer for PVC, lubricant, conditioning agent

Certificates

Image Unavailable-75835-376

Grob DA 280 Column Test Mix (11 components), Restek

Catalog Number: (75835-376)
Supplier: Restek
Description: Contains: n-decane, C10, 280 µg/ml, methyl decanoate, C10:0, 420 µg/ml, n-undecane, C11, 280 µg/ml, methyl undecanoate, C11:0, 420 µg/ml, methyl dodecanoate, C12:0, 420 µg/ml, L(+)-2,3-butanediol, 530 µg/ml, 2,6-dimethylaniline, 320 µg/ml, 2,6-dimethylphenol, 320 µg/ml, 2-ethylhexanoic acid, 380 µg/ml, nonanal, 400 µg/ml, 1-octanol, 360 µg/ml.
Product Image-10082-820

Anti-GFER Rabbit Polyclonal Antibody

Catalog Number: (10082-820)
Supplier: Proteintech
Description: GFER(FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria.The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus.
Image Unavailable-10771-956

Human Recombinant KGF (from E. coli)

Supplier: Peprotech
Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF (FGF-7) is a mitogen factor specific for epithelial cells and keratinocytes. KGF/FGF-7 signals through FGFR 2b. KGF (FGF-7) plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF (FGF-7) is an 18.9 kDa protein consisting of 163 amino acid residues.

Image Unavailable-103006-666

Rat Atrial Natriuretic Peptide (4-18)

Catalog Number: (103006-666)
Supplier: Anaspec Inc
Description: This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
881 - 896 of 71,531
no targeter for Bottom