Print…

You Searched For: (3-Fluorophenyl)acetic+acid


71,120  results were found

Refine Results Sort by
SearchResultCount:"71120"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAA14182-18

N-Phenylglycine 97%

Supplier: Thermo Scientific Chemicals
Description: Applications: Pharmaceutical intermediate.

Certificates

Image Unavailable-TCT2050-25G

Thiomorpholinoacetic acid-1',1'-dioxide monohydrate ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 155480-08-3
MDL Number: MFCD00121261
Molecular Formula: C6H11NO4S
Molecular Weight: 193.22
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Color: White
Melting point (°C): 177

SDS

Image Unavailable-TCT2599-5G

EDTA trisodium salt hydrate ≥98.0% (by titrimetric analysis) for biochemical research

Supplier: TCI America
Description: [for Biochemical Research]
CAS Number: 85715-60-2
MDL Number: MFCD00013305
Molecular Formula: C10H16N2O8
Molecular Weight: 358.19
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White

SDS

Image Unavailable-CA80108-488

Aldehyde Dehydrogenase

Catalog Number: (CA80108-488)
Supplier: MilliporeSigma
Description: Aldehyde dehydrogenase from yeast catalyzes the oxidation of acetaldehyde to acetic acid.

Certificates


Product Image-RC27301

EDTA disodium salt solution 0.1 mol/l in aqueous solution titrant

Supplier: Ricca Chemical
Description: Standardized at 25°C against chemicals whose certification is traceable to NIST.

SDS Certificates Small Business Enterprise

Image Unavailable-CA89167-802

Ponceau S 0.1% in dil. acetic acid membrane stain

Supplier: G-Biosciences
Description: Ponceau S is a rapid and reversible stain for detecting protein bands on Western blot membranes and can be used with PVDF, nitrocellulose and cellulose acetate membranes*. Ponceau S is a negative stain, which binds to the positively charged amino groups of the protein and it also binds non‐covalently to non‐polar regions in the protein.

SDS

Image Unavailable-CA1.37004.1000

Titriplex® III (ethylenedinitrilotetraacetic acid disodium salt dihydrate), EMPROVE® EXPERT Ph. Eur., BP, JP, USP, ACS, SAFC®

Supplier: EMD MILLIPORE – PCS CA EXCEP
Description: Titriplex* III (Ethylenedinitrotetraacetic acid disodium salt dihydrate) Emprove* bio Ph Eur, BP, JP, USP , ACS Chemical formula C10H14N2Na2O8,2H2Osuitable for the biopharmaceutical production

SDS Certificates

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-E-2835.0025BA

N-(Triphenylmethyl)glycine

Supplier: Bachem Americas
Description: Sequence: Trt-Gly-OH

Product Image-CA95029-566

EDTA disodium salt dihydrate for biochemistry

Supplier: G-Biosciences
Description: G-Biosciences' EDTA, or ethylenediamine-tetraacetic acid, is available as EDTA disodium salt dihydrate, supplied in four different sizes, as well as a 0.5M EDTA solution.
EDTA Specificity: A metal chelator that inhibits metalloproteases.

SDS

Image Unavailable-CA8.00077.0250

4'-Methylacetanilide for synthesis, Sigma-Aldrich®

Catalog Number: (CA8.00077.0250)
Supplier: MilliporeSigma
Description: 4'-Methylacetanilide, CAS number:103-89-9, Synonyms:N-p-Tolylacetamide, Acetic acid p-toluidide, 4-Acetamidotoluene, Application:for synthesis

SDS Certificates


Image Unavailable-TCE0099-500G

EDTA tetrasodium salt dihydrate ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 10378-23-1
MDL Number: MFCD00012460
Molecular Formula: C10H16N2O8
Molecular Weight: 380.17
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 300

SDS Certificates

Image Unavailable-TCH0660-025G

DL-4-Hydroxymandelic acid monohydrate ≥98.0% (by HPLC, titration analysis)

Catalog Number: (TCH0660-025G)
Supplier: TCI America
Description: CAS Number: 184901-84-6
MDL Number: MFCD00149283
Molecular Formula: C8H8O4
Molecular Weight: 168.15
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 99

SDS Certificates


Image Unavailable-CA1.08421.9025

Titriplex® III (ethylenedinitrilotetraacetic acid disodium salt dihydrate), EMPROVE® ESSENTIAL Ph. Eur., BP, USP, JP, SAFC®

Supplier: MilliporeSigma
Description: Suitable for use as excipient EMPROVE® exp.

Image Unavailable-CAEM4055

EDTA disodium salt dihydrate solution 0.5 M, OmniPur®, sterile, Millipore®

Supplier: MilliporeSigma
Description: For molecular biology. Prepared with diethyl pyrocarbonate for RNA applications. DNase-, RNase-, and protease-free.

SDS

Image Unavailable-CA1.08418.0100

EDTA disodium salt dihydrate, Titriplex® III, GR for analysis, Supelco®

Supplier: MilliporeSigma
Description: Grade ACS,ISO, reagent Ph Eur, Synonym disodium dihydrogen ethylenediaminetetraacetate, Ethylenediaminetetraacetic acid disodium salt, C10H14N2Na2O8* 2 H2O, Cas number 6381-92-6.

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,009 - 1,024 of 71,120
no targeter for Bottom