Print…

You Searched For: (2-Nitrophenyl)acetic+acid


66,900  results were found

Refine Results Sort by
SearchResultCount:"66900"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CA009-001-108

Human Native Collagen 6 (from Placenta)

Catalog Number: (CA009-001-108)
Supplier: Rockland Immunochemical
Description: 0.5mg. Protein Concentration: 2 mg/mL. Buffer: 0.5M acetic acid. Stabilizer: None. Preservative: None. For research. Liquid.

SDS


Image Unavailable-CAAAB21050-03

N-Fmoc-glycine 98%

Supplier: Thermo Scientific Chemicals
Description: N-Fmoc-glycine 98%

Certificates

Image Unavailable-TCB3702-5G

(4R,6R)-tert-Butyl-6-(2-aminoethyl)-2,2-dimethyl-1,3-dioxane-4-acetate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 125995-13-3
MDL Number: MFCD07369252
Molecular Formula: C14H27NO4
Molecular Weight: 273.37
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.02
Specific rotation [a]20/D: 15 deg (C=1, CHCl3)
Lambda max.: 204 nm (EtOH)

SDS

Image Unavailable-75800-930

10X TAE (Tris-Acetate EDTA), pH 8.3

Supplier: GROWCELLS
Description: TAE buffer is used in agarose gel electrophoresis and Polyacrylamide gels both as a buffer and a component of a gel

Image Unavailable-TCC2396-100G

Chitosan, 20-100 mPa.s (20 °C) 0.5% in acetic acid (0,5%)

Supplier: TCI America
Description: CAS Number: 9012-76-4
MDL Number: MFCD00161512
Form: Crystal
Color: Very Pale Yellow

SDS Certificates

Product Image-CA102902-458

BtsI-v2

Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned and modified BtsI gene from Bacillus thermoglucosidasius (X. Pan).

Image Unavailable-CAAA15294-36

Cerium triacetate sesquihydrate ≥99.9% (REO, rare earth oxide basis)

Supplier: Thermo Scientific Chemicals
Description: With bromide ion, catalyzes the liquid-phase auto-oxidation of cresols.

Certificates

Image Unavailable-CAAA81115-18

Vanadium(III) fluoride 98%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00042553 Practically insoluble in water, acetone, and glacial acetic acid

Certificates

Image Unavailable-CAAA11324-09

Cerium triacetate sesquihydrate ≥99.99% (REO, rare earth oxide basis), REacton®

Supplier: Thermo Scientific Chemicals
Description: Cerium(III) acetate is used in combination with bromide ion, catalyzes the liquid-phase auto-oxidation of cresols. It is used in glass manufacturing, glass Polishing, optical Glass making and polishing, pigments, pharma, Speciality chemicals electronic, oaint and driers, dyes and pigments, paper industries etc.

Certificates

Image Unavailable-TCN0092-025G

N-Nicotinoylglycine ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 583-08-4
MDL Number: MFCD00023578
Molecular Formula: C8H8N2O3
Molecular Weight: 180.16
Purity/Analysis Method: >98.0% (T)
Form: Crystal

SDS

Image Unavailable-75834-630

QuEChERS Performance Standard C, Restek

Catalog Number: (75834-630)
Supplier: Restek
Description: QuEChERS Performance Standard C (17 components), Concentration:300 ug/mL each in acetonitrile:acetic acid (99.9:0.1), Storage: 10 deg C or colder, Shelf Life: 3 months, Volume; 1 mL/ampule

Certificates


Image Unavailable-CAAAA15920-30

N-Phthaloylglycine 98+%

Supplier: Thermo Scientific Chemicals
Description: N-Phthaloylglycine 98+%

Certificates

Image Unavailable-CAAAA14957-0B

Bicine 99%

Supplier: Thermo Scientific Chemicals
Description: Good's buffers

Certificates

Image Unavailable-CA009-001-103

Human Collagen 1

Catalog Number: (CA009-001-103)
Supplier: Rockland Immunochemical
Description: 0.5mg. Protein Concentration: 1 mg/mL. Buffer: 0.5M acetic acid, pH 4.5. Stabilizer: None. Preservative: None. For research. Sterile filtered liquid.

SDS


Product Image-RC1120-16

Bouin's Fixative Solution, Ricca Chemical Company

Catalog Number: (RC1120-16)
Supplier: Ricca Chemical
Description: Picric acid-formalin-acetic acid mixture.

SDS Certificates Small Business Enterprise


Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,025 - 1,040 of 66,900
no targeter for Bottom