Print…

You Searched For: m-Toluic+acid


66,900  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"66900"

Rate These Search Results

Image Unavailable-CAAA11589-36

Zinc phosphate hydrate, tech.

Description: Soluble in acetic acid, dilute mineral acids, ammonia. Insoluble in water
Catalog Number: CAAA11589-36
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CA8.03235.9026

N,N-Dimethylacetamide ≥99% (by GC) for synthesis, Sigma-Aldrich®

Catalog Number: CA8.03235.9026
Supplier: MilliporeSigma

SDS Certificates


Image Unavailable-TCH0660-025G

DL-4-Hydroxymandelic acid monohydrate ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 184901-84-6
MDL Number: MFCD00149283
Molecular Formula: C8H8O4
Molecular Weight: 168.15
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 99
Catalog Number: TCH0660-025G
Supplier: TCI America

SDS Certificates


Product Image-CA102902-472

MluI-HF, Restriction Enzymes, New England Biolabs

Description: MluI-HF is produced in E. coli from a strain that carries the cloned and modified MluI gene from Micrococcus luteus (IFO 12992)
Catalog Number: CA102902-472
Supplier: New England Biolabs (NEB)
Image Unavailable-103008-246

Human Amylin Acetate

Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 103008-246
Supplier: Anaspec Inc
Image Unavailable-CA80502-382

EDTA disodium salt dihydrate, Molecular Biology Grade, Calbiochem®

Description: EDTA disodium salt dihydrate, Molecular Biology Grade, Calbiochem®
Catalog Number: CA80502-382
Supplier: MilliporeSigma

Certificates


Image Unavailable-75811-044

EDTA disodium salt dihydrate, BiotechGrade

Description: Edetate Disodium, Dihydrate, BiotechGrade is used in molecular biology applications to minimize metal ion contamination and prevent enzymatic activity. EDTA disodium dihydrate is routinely used in electrophoresis DNA and protein separation applications to chelate metal ions required for enzymatic activity that could potentially damage DNA and protein structure.
Catalog Number: 75811-044
Supplier: Spectrum Chemicals
Product Image-CA102902-468

NruI-HF, Restriction Enzymes, New England Biolabs

Description: NruI-HF is produced in E. coli from a strain that carries the cloned and modified NruI gene from Nocardia rubra (ATCC 15906).
Catalog Number: CA102902-468
Supplier: New England Biolabs (NEB)
Image Unavailable-TCD3789-5G

EDTA disodium salt dihydrate ≥99.0% (by titrimetric analysis) for biochemical research

Description: [for Biochemical Research]
CAS Number: 6381-92-6
MDL Number: MFCD00150037
Molecular Formula: C10H16N2O8
Molecular Weight: 336.21
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 252
Catalog Number: TCD3789-5G
Supplier: TCI America

SDS Certificates


Product Image-CA101418-186

PspXI

Description: An E.coli strain that carries the cloned PspXI gene from Pseudomanas species A1-1 (S.K. Degtyarev).
Catalog Number: CA101418-186
Supplier: New England Biolabs (NEB)
Image Unavailable-TCC0473-500G

trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate ≥99.0% (by titrimetric analysis)

Description: CAS Number: 125572-95-4
MDL Number: MFCD00149243
Molecular Formula: C14H22N2O8
Molecular Weight: 346.34
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 216
Catalog Number: TCC0473-500G
Supplier: TCI America

SDS Certificates


Image Unavailable-CA8.00077.0250

4'-Methylacetanilide for synthesis, Sigma-Aldrich®

Description: 4'-Methylacetanilide, CAS number:103-89-9, Synonyms:N-p-Tolylacetamide, Acetic acid p-toluidide, 4-Acetamidotoluene, Application:for synthesis
Catalog Number: CA8.00077.0250
Supplier: MilliporeSigma

SDS Certificates


Product Image-CAPI17892

EDTA disodium salt dihydrate, Pierce™

Description: Thermo Scientific Pierce EDTA is useful as a chelator of alkaline earth metals, as well as iron, copper and zinc in a variety of laboratory methods.
Catalog Number: CAPI17892
Supplier: Thermo Scientific

SDS Certificates


Image Unavailable-CAAAAA19646-22

Phenanthrene tech. 90%, Technical Grade

Description: MDL: MFCD00001168 Beilstein: 1905428 Soluble in alcohol, benzene, toluene, and glacial acetic acid
Catalog Number: CAAAAA19646-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCB4742-5G

4-(n-Butoxy)phenylacetic acid ≥98.0% (by GC, titration analysis)

Description: 4-Butoxyphenylacetic Acid, Purity:, Cas no. 4547-57-3, Molecular formula: C12H16O3, Form: Crystal- Powder, Colour: White - Slightly pale yellow, Size: 1G
Catalog Number: TCB4742-5G
Supplier: TCI America

SDS


Image Unavailable-E-2920.0005BA

Abz-Gly-OH·HCl

Description: Sequence: Abz-Gly-OH · HCl
Catalog Number: E-2920.0005BA
Supplier: Bachem Americas
1,105 - 1,120 of 66,900