You Searched For: Anaspec Inc

Description: OVA (323-339), Purity: Greater than or equal to 95% (HPLC), Formula: C84H134N28O27S1, Molecular weight: 2000.2, Sequence: Biotin-ISQAVHAAHAEINEAGR, Label: Biotin, Appearance: Powder, N-terminal OVA Peptide, amino acids 323 to 339, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-440

Supplier: Anaspec Inc

Sale

Description: C34, gp41 HIV Fragment, Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL, Purity: By HPLC >/= 95%, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide, Molecular Weight: 4248.6, Apperance: Powder, Size: 1 mg

Catalog Number: 103007-194

Supplier: Anaspec Inc

Sale

Description: Histone deacetylase, HDAC substrate, for the transcriptional regulation of gene expression, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-RGK(Ac)-AMC, Sequence (Three-Letter Code): Ac-Arg-Gly-Lys(Ac)-AMC, MW: 600.7, Storage: -20degree C, Size: 1mg

Catalog Number: 103007-068

Supplier: Anaspec Inc

Sale

Description: CEF8, Influenza Virus NP (383 - 391), SRYWAIRTR, HLA-B*3501 restricted influenza virus nucleoprotein epitope, Sequence (Three-Letter Code) H - Ser - Arg - Tyr - Trp - Ala - Ile - Arg - Thr - Arg - OH, MW: 1208.4, Physical State: Solid, at-20deg C, Size: 1mg

Catalog Number: 102997-152

Supplier: Anaspec Inc

Sale

Description: Melan - A, MART 1 (26 - 35), EAAGIGILTV, decapeptide, immunodominant antigen, Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Glu - Ala - Ala - Gly - Ile - Gly - Ile - Leu - Thr - Val - OH, MW: 943.5, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-244

Supplier: Anaspec Inc

Sale

Description: Quinine sulfate Dihydrate Fluorescence Reference Standard, CAS number: 6119-70-6, Molecular formula: (C20H24N2O2) 2* H2SO4.2H2O, Molecular weight: 782.96, Reference standard for measuring fluorescence quantum yield, Storage: -20 deg C, Size: 100 mg

Catalog Number: 103010-740

Supplier: Anaspec Inc

Sale

Description: Beta - Secretase Inhibitor 1, Sequence: KTEEISEVN - Sta - VAEF (Sta = statine), Molecular Weight: 1651.9, Apperance: Lyophilized white powder, Peptide Reconstitution: B-Secretase peptide is freely soluble in basic buffer, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-752

Supplier: Anaspec Inc

Sale

Description: DYKDDDDK, Purity: HPLC >/- 95%, Molecular Weight: 1013, Appearance: Powder, This epitope tag is a short hydrophilic, highly charged peptide. It is the most widely used epitope tag employed in structural and functional studies of proteins, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-362

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Luminescent Peroxidase Assay Kit *Luminometric*, Components: Substrate A 15 mL, Substrate B 15 mL, Peroxidase (Horseradish Peroxidase) standard 10 ug/mL, 100 ul, Assay buffer 60 mL, Optimized Performance, Enhanced Value, Assured Reliability

Catalog Number: 103010-462

Supplier: Anaspec Inc

Sale

Description: Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151), Purity %: Peak Area By HPLC >/= 95%, Molecular Weight 1862.7, Sequence(One-Letter Code): TRDI-pY-ETD-pY-pY-RK, Appearance: Lyophilized white powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-158

Supplier: Anaspec Inc

Sale

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-406

Supplier: Anaspec Inc

Sale

Description: Cls Substrate, C2 (Abz/Dnp), employs 2Abz/Dnp FRET pair for quantitation of complement enzyme activity, Purity: HPLC >/= 95%, Sequence (One-Letter Code): 2Abz-SLGRKIQIK(Dnp)-NH2, MW: 1326.5, Physical State: Lyophilized White Powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-570

Supplier: Anaspec Inc

Sale

Description: MAPS, Core, 8 - Branch, Purity: % Peak Area By HPLC greater than or equal to 95%, Molecular Weight 985.3, Sequence (One-Letter Code): K4K2KA-NH2, Appearance: Lyophilized white crystal, freely soluble in water, Storage: -20 deg C, Size: 10mg

Catalog Number: 102998-700

Supplier: Anaspec Inc

Sale

Description: gp91 ds-tat Peptide 2, sgp91 ds-tat Peptide 2, scrambled, Sequence: RKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC >/= 95%, peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor, Molecular Weight: 2453, Size: 1 mg

Catalog Number: 103007-786

Supplier: Anaspec Inc

Sale

Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg

Catalog Number: 103003-194

Supplier: Anaspec Inc

Sale

Description: Kinase Substrates Library, Group I, biotinylated, 180 distinct peptide mixtures, Purity: Unpurified, synthetic peptide combinatorial library (PS-SPCL) has been used in rapid identification of serine/threonine kinase phosphorylation motif, Storage -20 degree C

Catalog Number: 103006-936

Supplier: Anaspec Inc

Sale