Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-102999-616

Cys - beta - Amyloid (1 - 42) 0.5 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-616
Supplier: Anaspec Inc
Image Unavailable-103001-688

Human MMP-9 (Recombinant, Catalytic Domain)

Description: Human MMP-9 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 112-445), 40 kDa, Storage: -80 degree C, Size: 1ug
Catalog Number: 103001-688
Supplier: Anaspec Inc
Image Unavailable-103000-578

FITC-LC-TAT (47 - 57) 1 mg

Description: FITC-LC-TAT (47 - 57), Sequence (One-Letter Code): FITC-LC-YGRKKRRQRRR-NH2, Peptide Purity: >95%, Appearance: Lyophilized yellow powder, Molecular Weight: 2061.4, peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm, Size: 1 mg
Catalog Number: 103000-578
Supplier: Anaspec Inc
Image Unavailable-103010-206

DiSBAC2(3) 25 mg

Description: DiSBAC2(3) [[Bis-(1,3-diethylthiobarbituric acid)trimethine oxonol]], Purity: >99% HPLC/TLC, Molecular Formula: C19H24N4O4S2, MW: 436.5, Appearance: Purple solid, Sensitive membrane potential probe, less temperature-dependent than DiBAC, Storage: -20 deg C, Size: 25 mg
Catalog Number: 103010-206
Supplier: Anaspec Inc
Image Unavailable-103009-302

[Arg(Me2a)26]-Histone H3

Description: [Arg(Me2a)26]-Histone H3 (15-36)-GGK, H3R26(Me2a), Purity: HPLC >/= 95%, MW: 2704.2, Sequence: [APRKQLATKAA-R(Me2a)-KSAPATGGVKGG-K(Biotin)] This peptide is histone H3 (15-36) asymmetrically dimethylated at Arg26, biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-302
Supplier: Anaspec Inc
Image Unavailable-103009-502

[Lys(Me3)27-Histone H3 (23-34)-GGK

Description: [Lys(Me3)27-Histone H3 (23-34)-GGK, Purity: HPLC >/= 95%, MW: 1624.9, Sequence: [KAAR-K(Me3)-SAPATGGGG-K], trimethylated at Lys27 and biotinylated on the C-terminus through a GGK linker. Re-lyophilized to powder form. Store: -20 deg C, Size: 1mg
Catalog Number: 103009-502
Supplier: Anaspec Inc
Image Unavailable-103006-184

Proinsulin C - peptide (55 - 89) human 0.5mg

Description: Proinsulin C - peptide (55 - 89), human, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Molecular Weight: 3617, Physical State: Solid, Storage: -20 degree C, Size: 0.5mg
Catalog Number: 103006-184
Supplier: Anaspec Inc
Image Unavailable-103009-982

P0 (180-199)

Description: P0 (180-199), Purity: HPLC >/= 95%, MW: 2290.6, Sequence: Peripheral Myelin P0 Protein (180-199), mouse] This peptide is derived from murine peripheral myelin protein P0 amino acid residues 180-199. Apperance: Off white solid, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-982
Supplier: Anaspec Inc
Image Unavailable-103003-268

GSK3 Substrate a b subunit 1 mg

Description: GSK3 Substrate, a, b subunit, Purity: HPLC >/- 95%, Molecular Weight: 2631.8, Sequence: RAAVPPSPSLSRHSSPHQSEDEEE, Appearance: White Powder, This is a GSK-3 substrate, it can be used as a substrate for both alpha and beta isoforms of GSK3, Size: 1 mg
Catalog Number: 103003-268
Supplier: Anaspec Inc
Image Unavailable-103006-682

PDKtide 1 mg

Description: PDKtide peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): [protein fragment, 39 aa], Molecular Weight: 4771.4, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-682
Supplier: Anaspec Inc
Image Unavailable-102996-356

Neurotensin 10 mg

Description: Neurotensin, Purity: HPLC >/= 95%, Molecular Weight: 1673, Sequence: Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH, Appearance: White Powde, Storage: -20 deg C, Size: 10 mg
Catalog Number: 102996-356
Supplier: Anaspec Inc
Image Unavailable-103005-894

Steroid Receptor Co - Factor Peptide 1 mg

Description: Steroid Receptor Co - Factor Peptide, Purity: By HPLC >/= 95%, MW: 1786.1, Sequence: (One-Letter Code): LTERHKILHRLLQEDescription This peptide is a 14-amino acid fragment from the steroid receptor cofactor SRC-1 NR II, Size: 1 mg
Catalog Number: 103005-894
Supplier: Anaspec Inc
Image Unavailable-103008-228

[Lys(Me2)79]-Histone H3 (69-89)-K(Biotin) H3K79(Me2) 0.25mg

Description: [Lys(Me2)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2862.3, Sequence: RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin), Label: Biotin, Histone H3, Storage: -20 degree C, Size: 0.25mg
Catalog Number: 103008-228
Supplier: Anaspec Inc
Image Unavailable-103007-992

[Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin) H3K9/14(Ac) 0.25 mg

Description: [Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeled, Sequence: ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: By HPLC greater than or equal to 95%, Molecular Weight: 2807.3, Size: 0.25 mg
Catalog Number: 103007-992
Supplier: Anaspec Inc
Image Unavailable-103005-924

PEP1 1 mg

Description: PEP1, Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 3805.3, Sequence: (One-Letter Code): SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 This synthetic peptide mimics wild-type AH (amphipathic helix), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103005-924
Supplier: Anaspec Inc
Image Unavailable-103010-208

Oxonol VI 100 mg

Description: Oxonol VI [[Bis-(3-propyl-5-oxoisoxazol-4-yl)pentamethine oxonol]], CAS Number: 64724-75-0, Molecular Formula: C17H20N2O4, Molecular Weight: 316.4, Solvent System: DMSO, Apperance: dark solid, Faster response, Storage: -20 deg C, Size: 100 mg,
Catalog Number: 103010-208
Supplier: Anaspec Inc
81 - 96 of 1,262