You Searched For: Anaspec Inc

Description: gp91 ds-tat Peptide 2, sgp91 ds-tat Peptide 2, scrambled, Sequence: RKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC >/= 95%, peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor, Molecular Weight: 2453, Size: 1 mg

Catalog Number: 103007-786

Supplier: Anaspec Inc

Sale

Description: 2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL, Sequence: EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH, Purity: By HPLC >/= 95%, Molecular Weight: 1896, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-156

Supplier: Anaspec Inc

Sale

Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg

Catalog Number: 103003-194

Supplier: Anaspec Inc

Sale

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-406

Supplier: Anaspec Inc

Sale

Description: TAT - NSF700scr, Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL, (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide, Molecular Weight: 4109.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-244

Supplier: Anaspec Inc

Sale

Description: P53 (17-26) sequence contains the residues that contact the binding domain of Mdm-2, important in maintaining genome stability and preventing cancer development, Purity: HPLC>/=95%, Sequence (One-Letter Code): ETFSDLWKLL, Molecular weight: 1251.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-594

Supplier: Anaspec Inc

Sale

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-416

Supplier: Anaspec Inc

Sale

Description: [Gla17,21,24] - Osteocalcin (1 - 49), YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELADHIGFQEAYRRFYGPV (Gla=Y - Carboxyglutamic Acid, Disulfide bridge: 23 - 29), Molecular Weight: 5929.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-358

Supplier: Anaspec Inc

Sale

Description: Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151), Purity %: Peak Area By HPLC >/= 95%, Molecular Weight 1862.7, Sequence(One-Letter Code): TRDI-pY-ETD-pY-pY-RK, Appearance: Lyophilized white powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-158

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAARKSAPATGGV-K(Ac)-KPHRYRPGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-596

Supplier: Anaspec Inc

Sale

Description: Aminopeptidase N Ligand (CD13), NGR peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 606.7, Sequence: (One-Letter Code) CNGRCG (Disulfide bridge: 1-5), Appearance: White Powder, Storage: At -20 Degree C, Size: 5mg

Catalog Number: 103002-742

Supplier: Anaspec Inc

Sale

Description: D - Luciferin, potassium salt, UltraPure Grade, CAS number: 115144-35-9, Purity: >/=95% by HPLC, Luminescent substrate for firefly luciferase, MW: 318.41, Spectral Properties: Abs/Em = 328/532 nm, Solvent System: Water, MF: C11H7N2O3S2K, Storage -20 deg C, Size: 25 mg

Catalog Number: 103011-096

Supplier: Anaspec Inc

Sale

Description: Biotin - Oxytocin, Sequence: Biotin - CYIQNCPLG - NH2 (Disulfide bridge: 1 - 6), Purity: HPLC greater than or equal to 95%, N-terminally labeled with Biotin, synthesized primarily in the hypothalamic neurons, Molecular Weight: 1234.5, Apperance: Solid, Size: 1 mg

Catalog Number: 102999-778

Supplier: Anaspec Inc

Sale

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-422

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2765.2, Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin), Label: Biotin, Histone H3, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-090

Supplier: Anaspec Inc

Sale

Description: AnaTag* 5 - TAMRA Microscale Protein Labeling Kit *Ultra Convenient* Components: 5-TAMRA SE 3 vials, Reaction buffer 0.5 Ml, Spin column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 ml, Wash tube/Collect tube: 3 tubes, storage: 4 deg C

Catalog Number: 103010-384

Supplier: Anaspec Inc

Sale