You Searched For: Phenol red


1,262  results were found

SearchResultCount:"1262"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103011-052)
Supplier: Anaspec Inc
Description: DABCYL Plus* acid, acceptors for developing FRET-based nucleic acid probes and protease substrates, high hydrophobicity, poor water solubility, Purity: 95%, MW: 377.42, Spectral: Abs/Em = 437/none nm, Solvent System: Water or DMSO, Storage: -20 deg C, Size: 100 mg


Catalog Number: (103003-174)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg


Catalog Number: (103008-388)
Supplier: Anaspec Inc
Description: Histone H3 (21-44)-GK, Biotin


Catalog Number: (103010-564)
Supplier: Anaspec Inc
Description: Bacteria Recombinant Streptavidin (from <i>E. coli</i>)


Catalog Number: (103009-404)
Supplier: Anaspec Inc
Description: Vitronectin (367-378)


Catalog Number: (103007-136)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 15) - Lys16(HiLyte* Fluor 488), Human, B-Amyloid peptide, residues 1 to 16 labeled with HiLyte* Fluor 488 on the Lys16, Abs/Em =501/527, Molecular Weight: 2311.4, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (102999-782)
Supplier: Anaspec Inc
Description: Cecropin A, Sequence: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4003.8, Apperance: Lyophilized white powder,Peptide Reconstitution: Cecropin A peptide is freely soluble in H2O, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103010-852)
Supplier: Anaspec Inc
Description: 6-TAMRA, SE, Synonym: 6-Carboxytetramethylrhodamine, succinimidyl ester; 6-TAMRA, NHS ester, purified single isomer, for nucleotide labeling and DNA sequencing, Molecular Weight: 527.53, Spectral Properties: Abs/Em = 547/573 nm, Solvent System: DMF or DMSO, Size: 5 mg


Catalog Number: (103001-638)
Supplier: Anaspec Inc
Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-40) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate


Catalog Number: (102996-396)
Supplier: Anaspec Inc
Description: Human Glucagon-Like Peptide 1, GLP-1 amide, FAM-labeled


Catalog Number: (103007-798)
Supplier: Anaspec Inc
Description: Suc-LLVY-AMC, fluorogenic substrate, Sequence: Suc-LLVY-AMC, Purity: By HPLC >/= 95%, used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases, Molecular Weight: 763.9, Storage: -20 deg C, Size: 5 mg


Catalog Number: (103003-410)
Supplier: Anaspec Inc
Description: Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3482.8, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, this peptide secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels, Size: 1 mg


Catalog Number: (103011-230)
Supplier: Anaspec Inc
Description: Calcein, AM UltraPure Grade, Small Package, for determining cell viability, Purity: >/= 95% by HPLC, MW: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Solvent System: DMSO, MF: C46H46N2O23, CAS number: 148504-34-1, Physical State: Solid, Storage -20 deg C, Size: 50 ug x 20


Catalog Number: (103011-196)
Supplier: Anaspec Inc
Description: Pluronic* F-127, 10% solution in water, Cell culture reagent for dissolving AM esters, Solution: solution, Storage: 4 degree C protected from light, Store away from oxidizing agent, Size: 100 mL


Catalog Number: (103007-638)
Supplier: Anaspec Inc
Description: [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4530.2, Apperance: Lyophilized white powder, Storage: -20 C, Size: 0.5 mg


Catalog Number: (103009-890)
Supplier: Anaspec Inc
Description: [Lys(Ac)5]-Histone H4 (1-25)-GSGSK(Biotin); H4K5(Ac), Purity: HPLC >/= 95%, Molecular weight: 3274.8, Sequence: [SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)] This peptide is histone H4 (1-25) with acetylation at Lys5. Biotin - labeled, Store: -20 deg C, Size: 1mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
33 - 48 of 1,262
no targeter for Bottom