You Searched For: Anaspec Inc

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103006-504

Supplier: Anaspec Inc

Sale

Description: 5-TAMRA Lysine, Synonym: Tetramethylrhodamine-5-carboxamide lysine, building block and a good transglutaminase substrate, Molecular Weight: 558.62, Spectral Properties: Abs/Em = 545/575 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-034

Supplier: Anaspec Inc

Sale

Description: B8R (20-27), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 960.1, Sequence: TSYKFESV, amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-426

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AMC tPA Activity Assay Kit *Fluorimetric*, Components: tPA substrate 4 mM, 50 uL, AMC 4 mM, 10 uL, 2X Assay Buffer 10 mL, Purified tPA enzyme 25 Units/uL, 40 uL, tPA Inhibitor 10 mM, 100 uL, Optimized Performance, Enhanced Value, Assured Reliability

Catalog Number: 103010-524

Supplier: Anaspec Inc

Sale

Description: West Nile Virus NS3 Protease, recombinant, Concentration: 100 ug/ml, is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus, positive sense 11kb RNA genome, Storage: -80 deg C, size: 100 ug

Catalog Number: 103010-402

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 500ug

Catalog Number: 102998-100

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Neprilysin Activity Assay Kit *Fluorimetric*, Components: 5-FAM/QXLTM-520 Neprilysin substrate 1 mM, 50 uL, 5-FAM 1 mM, 15 uL, Recombinant human neprilysin 10 ug/mL, 100 uL, 2X Assay Buffer 30 mL, Inhibitor 0.1 mM, 15 uL

Catalog Number: 103010-662

Supplier: Anaspec Inc

Sale

Description: 5(6) - CFDA, SE, Synonym: 5 - (and - 6) - Carboxyfluorescein diacetate, succinimidyl ester Mixed Isomers; 5(6) - CFDA, NHS ester, Reactive pH indicator for slightly acidic pH range, MW: 557.5, Spectral Properties: Abs/Em = 492/517 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-388

Supplier: Anaspec Inc

Sale

Description: Bim BH3, Peptide IV, Sequence: DMRPEIWIAQELRRIGDEFNAYYARR, Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins, Molecular Weight: 3269.7, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-272

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-42) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-640

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)40]-Ac-a-Tubulin (29-50)-WGK(Biotin); TubK40(Ac)-WGK, Purity: HPLC >/= 95%, MW: 2918.2, Sequence: [Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)], with a C-terminal WG linker followed by a biotinylated lysine. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-516

Supplier: Anaspec Inc

Sale

Description: Human ACE Substrate 2

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XIV, QXL™ 520-FAM, AnaSpec

Catalog Number: 103005-942

Supplier: Anaspec Inc

Sale

Description: Ala - Y - D - Glu - DAP, Purity: >/= 95%, MW: 390.4, Sequence: (One-Letter Code): A-(Y-e)-DAPwith the diaminopimelic acid coupled to the Y-carboxylic acid of the D-isomer of Glu, Appearance: Lyophilized white solid, Storage: -20 degree Celcius, Size: 1 mg

Catalog Number: 103005-974

Supplier: Anaspec Inc

Sale

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: Human LL-37

Catalog Number: 103007-242

Supplier: Anaspec Inc

Sale