Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-102999-346

Human Beta-Amyloid (40-1)

Description: Human Beta-Amyloid (40-1)
Catalog Number: 102999-346
Supplier: Anaspec Inc
Image Unavailable-103011-276

3,3'-Dipropylthiadicarbocyanine iodide [DiSC3(5)] ≥95% (by HPLC)

Description: 3,3'-Dipropylthiadicarbocyanine iodide [DiSC3(5)] ≥95% (by HPLC)
Catalog Number: 103011-276
Supplier: Anaspec Inc
Image Unavailable-103003-546

Beta - Amyloid (1 - 40) - Lys(Biotin - LC) 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.1 mg
Catalog Number: 103003-546
Supplier: Anaspec Inc
Image Unavailable-103010-900

7-(Diethylamino)coumarin-3-carboxylic acid, N-succinimidyl ester ≥95% (by HPLC)

Description: 7-(Diethylamino)coumarin-3-carboxylic acid, N-succinimidyl ester ≥95% (by HPLC)
Catalog Number: 103010-900
Supplier: Anaspec Inc
Image Unavailable-103007-802

Exendin (5-39) 1 mg

Description: Exendin (5-39), Sequence: TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Purity: By HPLC greater than or equal to 95%, This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1, Molecular Weight: 3806.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-802
Supplier: Anaspec Inc
Image Unavailable-103008-062

OVA-Q4 Peptide, pQ4, OVA (257-264) Variant   1 mg

Description: OVA-Q4 Peptide, pQ4, OVA (257-264) Variant  , Sequence: SIIQFEKL, Purity: By HPLC greater than or equal to 95%, variant of the agonist ovalbumin (OVA) peptide (257-264), Molecular Weight: 977.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-062
Supplier: Anaspec Inc
Image Unavailable-103007-122

Beta - Amyloid (22 - 42) 1 mg

Description: Beta - Amyloid (22 - 42), Human, mouse/rat, Sequence: EDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42, Molecular Weight: 1999.4, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-122
Supplier: Anaspec Inc
Image Unavailable-103008-726

C5a Receptor Agonist 1mg

Description: C5a Receptor Agonist, mouse, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 853.1, Sequence: FKP-(D-Cha)-Cha-r, Appearance: Off-White solid, derived from C-terminus of the chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg
Catalog Number: 103008-726
Supplier: Anaspec Inc
Image Unavailable-103007-660

[Lys(Ac)5]-Histone H4 (1-20) H4K5(Ac) 1 mg

Description: [Lys(Ac)5]-Histone H4 (1-20), H4K5(Ac), Sequence: SGRG-K(Ac)-GGKGLGKGGAKRHRK, Purity: By HPLC greater than or equal to 95%, histone 4 peptide acetylated at lysine 5, Molecular Weight: 2034.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-660
Supplier: Anaspec Inc
Image Unavailable-103008-214

Prostatic Acid Phosphatase (248-286) 1mg

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-214
Supplier: Anaspec Inc
Image Unavailable-103003-078

Biotin-Glucagon (1-29) 1 mg

Description: Biotin-Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3709.1, Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, Size: 1 mg
Catalog Number: 103003-078
Supplier: Anaspec Inc
Image Unavailable-103010-348

AnaTag* HiLyte* Fluor 750 Microscale Protein Labeling Kit

Description: AnaTag* HiLyte* Fluor 750 Microscale Protein Labeling Kit *Ultra Convenient*, It provides ample materials to perform three protein conjugations and purifications, One conjugation reaction can label up to 200 ug proteins, storage: 4 deg C
Catalog Number: 103010-348
Supplier: Anaspec Inc
Image Unavailable-103010-248

SensoLyte* 520 MMP Substrate Sampler Kit

Description: SensoLyte* 520 MMP Substrate Sampler Kit *Fluorimetric*, Components: 16 different MMP substrates 100 u
M, 150 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 50 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed
Catalog Number: 103010-248
Supplier: Anaspec Inc
Image Unavailable-103011-368

TMRE 25 mg

Description: TMRE, Synonym: Tetramethylrhodamine, ethyl ester, perchlorate, for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 514.96, Spectral Properties: Abs/Em = 549/574 nm, Solvent System: DMSO, CAS: 115532-52-0, Size: 25 mg
Catalog Number: 103011-368
Supplier: Anaspec Inc
Image Unavailable-103011-132

4',6'-Diamidino-2-phenylindole dihydrochloride (DAPI dihydrochloride)

Description: 4',6'-Diamidino-2-phenylindole dihydrochloride (DAPI dihydrochloride)
Catalog Number: 103011-132
Supplier: Anaspec Inc
Image Unavailable-103009-058

[Lys(Ac)20]-Histone H4 (1-25)-GSGSK,Biotin

Description: [Lys(Ac)20]-Histone H4 (1-25)-GSGSK,Biotin
Catalog Number: 103009-058
Supplier: Anaspec Inc
481 - 496 of 1,262