You Searched For: Anaspec Inc

Description: [Lys(Ac)16]-Histone H4 (1-25)-GSGSK(Biotin); H4K16(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3274.8, Sequence: SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-050

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XIII, Purity: By HPLC >/= 95%, MW: 2143.3, Sequence: (One-Letter Code): 5-FAM-RPKPVE-Nva-WRK(QXL* 520)-NH2for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521nm, Appearance: Lyophilized red powder, Size: 0.1 mg

Catalog Number: 103005-940

Supplier: Anaspec Inc

Sale

Description: SensoLyte*Plus 520 MMP-2 Assay Kit *Fluorimetric and Enhanced Selectivity*, is designed specifically for detecting MMP-2 activity in biological samples such as culture medium, serum, plasma, synovial fluid, and tissue homogenate, which may contain multiple MMPs

Catalog Number: 103010-664

Supplier: Anaspec Inc

Sale

Description: Phosphopeptide Mass Spec Standard kit, Purity: HPLC >/= 95%, contains 6 Phosphopeptides at 10 ug each (6 vials), for the characterization of affinity purified phosphorylated peptides in liquid chromatography / mass spectrometry, Storage: -20 degree C

Catalog Number: 103006-362

Supplier: Anaspec Inc

Sale

Description: Amylin (1 - 37), human, amide, Purity: HPLC >/- 95%, Molecular Weight: 3903.3, Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-052

Supplier: Anaspec Inc

Sale

Description: JC-1, Synonym: 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolylcarbocyanine iodide, for measuring membrane potential of mitochondria; 585/520 Fluorescence ratio increases upon cell hyper-polarization, MW: 652.2, Spectral: Abs/Em = 514/529 nm, Solvent System: DMSO, Size: 5 mg

Catalog Number: 103011-366

Supplier: Anaspec Inc

Sale

Description: TRP - 2 (180 - 188) (SVYDFFVWL), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): H - Ser - Val - Tyr - Asp - Phe - Phe - Val - Trp - Leu - OH, Molecular Weight: 1175.4, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-330

Supplier: Anaspec Inc

Sale

Description: CEF30, Epstein-Barr Virus BRLF1 (134-142), HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142), Molecular Weight: 955.2, Sequence (1-Letter Code): ATIGTAMYK, Physical State: Solid, Storage: -20C Store away from oxidizing agent, Size: 1mg

Catalog Number: 103004-216

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP - 14 Assay Kit *Fluorimetric*, Components: MMP-14 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, Organic mercury 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-304

Supplier: Anaspec Inc

Sale

Description: Penetratin, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2360.9, Sequence: RQIKIWFQNRRMKWKKGG, cell-penetrating peptide (CPP), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-578

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (3-42), Human, Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-524

Supplier: Anaspec Inc

Sale

Description: Growth Hormone Releasing Factor, GRF (1-29), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3357.9, Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, this peptide was isolated from human hypothalamic-hypophysial tissues, Size: 0.5 mg

Catalog Number: 102996-318

Supplier: Anaspec Inc

Sale

Description: Protein A - HiLyte* Fluor 647 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Near-infrared Fluorescence, Excitation/Emission wavelength= 649 nm/ 674 nm, Applications: to detect primary antibodies in IHC from many species rabbit, human, size: 1 mg

Catalog Number: 103010-696

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-8 Assay Kit *Fluorimetric*, Components: MMP-8 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-238

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide(1-28), Purity: HPLC >/= to 95%, Molecular Weight: 3080.5, Sequence: H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-GlyAla-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe, Appearance: Lyophilized white powder, Size: 1 mg

Catalog Number: 102996-076

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (11-17), Human, Sequence: EVHHQKL, Purity: By HPLC greater than or equal to 95%, This is a short fragment of the b-Amyloid peptide containing Histidine 13 and 14, Molecular Weight: 890, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-748

Supplier: Anaspec Inc

Sale