You Searched For: Anaspec Inc

Description: IRBP (1 - 20), human, Sequence: GPTHLFQPSLVLDMAKVLLD, 1 to 20 amino acid fragment of the interphotoreceptor retinoid binding protein, 140-kDa glycolipoprotein residing, Molecular Weight: 2194.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-278

Supplier: Anaspec Inc

Sale

Description: Aminopeptidase N Ligand (CD13), NGR peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 606.7, Sequence: (One-Letter Code) CNGRCG (Disulfide bridge: 1-5), Appearance: White Powder, Storage: At -20 Degree C, Size: 5mg

Catalog Number: 103002-742

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (1-21),Biotin

Catalog Number: 103009-902

Supplier: Anaspec Inc

Sale

Description: Kemptide, FAM (Carboxyfluorescein)

Catalog Number: 102997-404

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Plasmin Activity Assay Kit *Fluorimetric*, Components: Plasmin substrate 5 mM, 50 uL, Rh110 5 mM, 10 uL, Human plasmin 250 ug/mL, 10 uL, 2X Assay Buffer 10 mL, Plasmin Inhibitor 1 mM, 10 uL, Stop Solution 5 mL, storage: -20 deg C

Catalog Number: 103010-458

Supplier: Anaspec Inc

Sale

Description: <i>Staphylococcus aureus</i> Delta-Toxin (1-26)

Catalog Number: 103007-368

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Enterokinase Activity Assay Kit *Fluorimetric*, Components: Rh110 Enterokinase substrate 2 mM, 50 uL, Rh110 2 mM, 10 uL, Recombinant bovine enterokinase 40 uL, 2X Assay Buffer 25 mL, Enterokinase Inhibitor 50 mM, 20 uL

Catalog Number: 103010-628

Supplier: Anaspec Inc

Sale

Description: gp91 ds-tat Peptide 2, sgp91 ds-tat Peptide 2, scrambled, Sequence: RKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC >/= 95%, peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor, Molecular Weight: 2453, Size: 1 mg

Catalog Number: 103007-786

Supplier: Anaspec Inc

Sale

Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg

Catalog Number: 103003-194

Supplier: Anaspec Inc

Sale

Description: 2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL, Sequence: EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH, Purity: By HPLC >/= 95%, Molecular Weight: 1896, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-156

Supplier: Anaspec Inc

Sale

Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 10 mg

Catalog Number: 103010-222

Supplier: Anaspec Inc

Sale

Description: Prototype of RGD-containing peptide, Purity: HPLC >/- 95%, Molecular Weight: 1091.6, Sequence: FITC-LC-Gly-Arg-Gly-Asp-Ser-Pro-OH, label: FITC, Appearance: Lyophilized red powder, This is a fluorescent labeled Prototype of RGD-containing peptide, Size: 1 mg

Catalog Number: 103003-270

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 hydroxylamine, HCl salt *single isomer*, Abs/Em = 498/525 nm, Purity: HPLC >/=95%, Sequence (1-Letter Code): HiLyte* Fluor 488 C2-aminooxyacetamide, HCl salt *single isomer*, MW: 525.94, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-524

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2946.5, Sequence: AT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-302

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 HCV Protease Assay Kit *Fluorimetric*, Components: HCV NS3/4A protease substrate 120 ul, 5-FAM 100 u
M, 5 ul, 2X Assay buffer 10 mL, Stop solution 10 mL, DTT 1 M, 0.5 mL, Pep4AK 50 ul, 600 u
M, with Convenient Format, Enhanced Value

Catalog Number: 103010-174

Supplier: Anaspec Inc

Sale

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-560

Supplier: Anaspec Inc

Sale