Print…

You Searched For: tetra-Potassium+diphosphate


1,262  results were found

Refine Results Sort by
SearchResultCount:"1262"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-538

Human Beta-Amyloid (11-25)

Catalog Number: (103007-538)
Supplier: Anaspec Inc
Description: Human Beta-Amyloid (11-25)
Image Unavailable-103007-598

Human Beta-Amyloid (11-42)

Catalog Number: (103007-598)
Supplier: Anaspec Inc
Description: Human Beta-Amyloid (11-42)
Image Unavailable-103007-616

5-FAM-PMDM6 (PMDM6-F) 1 mg

Catalog Number: (103007-616)
Supplier: Anaspec Inc
Description: 5-FAM-PMDM6 (PMDM6-F), Sequence: 5-FAM-(B-A)-(B-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2, Purity: By HPLC greater than or equal to 95%, PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay, Molecular Weight: 1784.3, Storage: -20 deg C, Size: 1 mg
Image Unavailable-103008-586

SPase I FRET Substrate 1mg

Catalog Number: (103008-586)
Supplier: Anaspec Inc
Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: (103008-536)
Supplier: Anaspec Inc
Description: [Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin
Image Unavailable-102996-412

PACAP (1-38)-Lys(Biotin) 0.5 mg

Catalog Number: (102996-412)
Supplier: Anaspec Inc
Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Image Unavailable-102996-498

Oxytocin 25 mg

Catalog Number: (102996-498)
Supplier: Anaspec Inc
Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 25 mg
Image Unavailable-103007-804

Fluorescein-Trp25-Exendin-4 (FLEX) 0.5 mg

Catalog Number: (103007-804)
Supplier: Anaspec Inc
Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg
Image Unavailable-103007-790

P70 S6 Kinase Substrate 1 mg

Catalog Number: (103007-790)
Supplier: Anaspec Inc
Description: P70 S6 Kinase Substrate, Sequence: KKRNRTLTV, Purity: By HPLC greater than or equal to 95%, This peptide is a substrate for p70 ribosomal S6 kinase, Molecular Weight: 1115.4, Storage: -20 deg C, Size: 1 mg
Image Unavailable-103007-746

gp91 ds-tat 1 mg

Catalog Number: (103007-746)
Supplier: Anaspec Inc
Description: gp91 ds-tat, Sequence: YGRKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide, Molecular Weight: 2673.2, Storage: -20 deg C, Size: 1 mg
Image Unavailable-103008-620

[pThr11]-Histone H3(1-21)-GGK(Biotin) H3pT11 1mg

Catalog Number: (103008-620)
Supplier: Anaspec Inc
Description: [pThr11]-Histone H3(1-21)-GGK(Biotin), H3pT11, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2802.2, Sequence: ARTKQTARKS-pT-GGKAPRKQLAGG-K(Biotin)-NH2, Label: Biotin, histone H3 amino acid 1-21, Storage: -20 degree C, Size: 1mg
Image Unavailable-103007-104

Beta - Amyloid (1 - 17 1 mg

Catalog Number: (103007-104)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Image Unavailable-103007-098

Colivelin

Catalog Number: (103007-098)
Supplier: Anaspec Inc
Description: Colivelin
Image Unavailable-103007-334

Beta-Amyloid (1-40) Binding Peptide,Biotin

Catalog Number: (103007-334)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-40) Binding Peptide,Biotin
Image Unavailable-103007-418

Caloxin 2A1

Catalog Number: (103007-418)
Supplier: Anaspec Inc
Description: Caloxin 2A1
Image Unavailable-103007-392

Glutamate Receptor Endocytosis Inhibitor GluR23Y 1 mg

Catalog Number: (103007-392)
Supplier: Anaspec Inc
Description: Glutamate Receptor Endocytosis Inhibitor, GluR23Y, Sequence: YKEGYNVYG, Purity: By HPLC >/= 95%, used in ELISA cell-surface assay for insulin-stimulated endocytosis of native AMPA receptors, Molecular Weight: 1092.2, Storage: -20 C, Size: 1 mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
49 - 64 of 1,262
no targeter for Bottom