You Searched For: Anaspec Inc

Description: Beta - Amyloid (22 - 42), Human, mouse/rat, Sequence: EDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42, Molecular Weight: 1999.4, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-122

Supplier: Anaspec Inc

Sale

Description: C5a Receptor Agonist, mouse, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 853.1, Sequence: FKP-(D-Cha)-Cha-r, Appearance: Off-White solid, derived from C-terminus of the chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-726

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)5]-Histone H4 (1-20), H4K5(Ac), Sequence: SGRG-K(Ac)-GGKGLGKGGAKRHRK, Purity: By HPLC greater than or equal to 95%, histone 4 peptide acetylated at lysine 5, Molecular Weight: 2034.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-660

Supplier: Anaspec Inc

Sale

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4551.5, Sequence: GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY, Appearance: Powder, SEVI factor found in semen, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-214

Supplier: Anaspec Inc

Sale

Description: Biotin-Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3709.1, Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, Size: 1 mg

Catalog Number: 103003-078

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 750 Microscale Protein Labeling Kit *Ultra Convenient*, It provides ample materials to perform three protein conjugations and purifications, One conjugation reaction can label up to 200 ug proteins, storage: 4 deg C

Catalog Number: 103010-348

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP Substrate Sampler Kit *Fluorimetric*, Components: 16 different MMP substrates 100 u
M, 150 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 50 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed

Catalog Number: 103010-248

Supplier: Anaspec Inc

Sale

Description: TMRE, Synonym: Tetramethylrhodamine, ethyl ester, perchlorate, for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 514.96, Spectral Properties: Abs/Em = 549/574 nm, Solvent System: DMSO, CAS: 115532-52-0, Size: 25 mg

Catalog Number: 103011-368

Supplier: Anaspec Inc

Sale

Description: 4',6'-Diamidino-2-phenylindole dihydrochloride (DAPI dihydrochloride)

Catalog Number: 103011-132

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)20]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: 103009-058

Supplier: Anaspec Inc

Sale

Description: Mouse Protease Activated Receptor 4

Catalog Number: 103005-978

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 B-Secretase Assay Kit *Fluorimetric*, Components: ?-secretase substrate 60 ul, HiLyte Fluor* 488 1 mM DMSO solution, 20 ul, ?-secretase Inhibitor 250 u
M, 10 ul, 2X Assay buffer 20 Ml, Stop Solution 10 mL, Human ?-secretase 0.5 mg/mL, 20 ul

Catalog Number: 103010-172

Supplier: Anaspec Inc

Sale

Description: Influenza Virus Control Peptide Pool, peptides have been used in the stimulation of IFNY release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3 mg

Catalog Number: 103007-298

Supplier: Anaspec Inc

Sale

Description: KALA

Catalog Number: 103009-960

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (4-42)

Catalog Number: 103000-892

Supplier: Anaspec Inc

Sale

Description: NBD-X, SE, CAS number: 145195-58-0, Synonym: Succinimidyl 6-(N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)hexanoate; NBD-X, NHS ester, Molecular Weight: 391.34, Purity: >/= 95% by HPLC, Spectral Properties: Abs/Em = 466/535 nm, Solvent System: DMF or DMSO, Size: 25 mg

Catalog Number: 103010-904

Supplier: Anaspec Inc

Sale