Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103010-740

Quinine sulfate

Description: Quinine sulfate
Catalog Number: 103010-740
Supplier: Anaspec Inc
Image Unavailable-102999-358

[Gla17,21,24] - Osteocalcin (1 - 49) 1 mg

Description: [Gla17,21,24] - Osteocalcin (1 - 49), YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELADHIGFQEAYRRFYGPV (Gla=Y - Carboxyglutamic Acid, Disulfide bridge: 23 - 29), Molecular Weight: 5929.5, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-358
Supplier: Anaspec Inc
Image Unavailable-103011-028

5(6)-TAMRA cadaverine 10 mg

Description: 5(6)-TAMRA cadaverine, Synonym: Tetramethylrhodamine 5-(and-6)-carboxamide cadaverine, reagent for modifying carboxy groups via EDC-mediated reactions, Molecular Weight: 514.62, Spectral Properties: Abs/Em = 544/570 nm, Solvent System DMF or DMSO, Size: 10 mg
Catalog Number: 103011-028
Supplier: Anaspec Inc
Image Unavailable-103011-036

Sulforhodamine 101 cadaverine

Description: Sulforhodamine 101 cadaverine
Catalog Number: 103011-036
Supplier: Anaspec Inc
Image Unavailable-103011-096

D - Luciferin 25 mg

Description: D - Luciferin, potassium salt, UltraPure Grade, CAS number: 115144-35-9, Purity: >/=95% by HPLC, Luminescent substrate for firefly luciferase, MW: 318.41, Spectral Properties: Abs/Em = 328/532 nm, Solvent System: Water, MF: C11H7N2O3S2K, Storage -20 deg C, Size: 25 mg
Catalog Number: 103011-096
Supplier: Anaspec Inc
Image Unavailable-103011-030

5-TAMRA cadaverine 5 mg

Description: 5-TAMRA cadaverine, Synonym: Tetramethylrhodamine-5-carboxamide cadaverine, purified single isomer of 5(6)-TAMRA cadaverine mixture, for biological application, MW: 514.62, Spectral Properties: Abs/Em = 545/576 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 5 mg
Catalog Number: 103011-030
Supplier: Anaspec Inc
Image Unavailable-102997-152

Influenza CEF Influenza

Description: Influenza CEF Influenza
Catalog Number: 102997-152
Supplier: Anaspec Inc
Image Unavailable-103001-346

Human Recombinant MMP-12 (from E. coli)

Description: Human Recombinant MMP-12 (from <i>E. coli</i>)
Catalog Number: 103001-346
Supplier: Anaspec Inc
Image Unavailable-103002-830

M13 Skeletal Muscle Myosin Light Chain Kinase Peptide 1mg

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK - MLCK M13, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2964.5, Sequence: (One-Letter Code) KRRWKKNFIAVSAANRFKKISSSGAL, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103002-830
Supplier: Anaspec Inc
Image Unavailable-103002-832

M13 Skeletal Muscle Myosin Light Chain Kinase Peptide

Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide
Catalog Number: 103002-832
Supplier: Anaspec Inc
Image Unavailable-103002-842

Chicken OVA (257-264)

Description: Chicken OVA (257-264)
Catalog Number: 103002-842
Supplier: Anaspec Inc
Image Unavailable-103003-406

Glucagon (1-37) Oxyntomodulin 1 mg

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-406
Supplier: Anaspec Inc
Image Unavailable-103003-348

Human Fibrinopeptide B

Description: Human Fibrinopeptide B
Catalog Number: 103003-348
Supplier: Anaspec Inc
Image Unavailable-103003-362

Epitope tag

Description: Epitope tag
Catalog Number: 103003-362
Supplier: Anaspec Inc
Image Unavailable-103010-018

Human Protease Activated Receptor 1

Description: Human Protease Activated Receptor 1
Catalog Number: 103010-018
Supplier: Anaspec Inc
Image Unavailable-103009-972

Mouse pVEC (Cadherin-5)

Description: Mouse pVEC (Cadherin-5)
Catalog Number: 103009-972
Supplier: Anaspec Inc
369 - 384 of 1,262