You Searched For: Anaspec Inc

Description: Beta-Amyloid (11-42), HiLyte* Fluor 488-labeled, Human, Sequence: HiLyte* Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, b-amyloid peptide labeled with HiLyte* Fluor 488, Molecular Weight: 3692.3, Size: 0.1 mg

Catalog Number: 103007-610

Supplier: Anaspec Inc

Sale

Description: Magainin 1, Purity: HPLC >/= to 95%, Molecular Weight: 2409.9, Sequence: GIGKFLHSAGKFGKAFVGEIMKS, Appearance: Lyophilized white powde, it is peptide antibiotics with antibacterial and antiparasitic activities, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-124

Supplier: Anaspec Inc

Sale

Description: AnaTag* AMCA - X Protein Labeling Kit *Ultra Convenient* ComponentS: AMCA-X SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 1 ml, 10X Elution buffer 30 ml, One conjugation reaction can label up to 5 mg protein

Catalog Number: 103010-366

Supplier: Anaspec Inc

Sale

Description: Pluronic* F-127 Cell Culture Tested, Solvent System: Water, Cell culture reagent for dissolving AM esters, CAS Number: 9003-11-6, Physical State: Solid, Storage: -20 degree C, Store away from oxidizing agent, Size: 10 g

Catalog Number: 103011-192

Supplier: Anaspec Inc

Sale

Description: Linear C5a Receptor Antagonist, rat, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 886.1, Sequence: FKP-(D-Cha)-Wr, linear peptide is derived from C-terminus of chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-728

Supplier: Anaspec Inc

Sale

Description: Neurotensin (8-13), Purity: HPLC >/= 95%, Molecular Weight: 817, Sequence: H-Arg-Arg-Pro-Tyr-Ile-Leu-OH, The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-346

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XI, Purity: % Peak Area By HPLC >/= 95%, MW: 1567.6, Sequence: (One-Letter Code): 5-FAM-P-Cha-G-Nva-HA-Dap(QXL* 520)-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-936

Supplier: Anaspec Inc

Sale

Description: Somatostatin 28, human, sheep, cow, rat, mouse, pig, Purity: HPLC >/= to 95%, Molecular Weight: 3148.6, Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC, is a cyclic peptide existing in two isoforms and is produced in the pancreas islet, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-328

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA, SE, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, succinimidyl ester; 5(6)-TAMRA, NHS ester, for preparing peptide, protein, nucleotide, nucleic acid conjugates, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Appearance: Dark red solid, Size: 100 mg

Catalog Number: 103010-846

Supplier: Anaspec Inc

Sale

Description: SAM PEP 1, FAM labeled, AMPK substrate peptide, FAM labeled, Sequence: 5-FAM-HMRSAMSGLHLVKRR, Purity: HPLC >/= 95%, can be used as a substrate for APK in vitro kinase assays, Molecular Weight: 2137.5, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-732

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), Biotinylated, used to investigate the mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes, Purity: HPLC >/=95%, Sequence (1-Letter Code): ARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-NH2, MW: 2723.2, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-912

Supplier: Anaspec Inc

Sale

Description: [pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled, Sequence: ARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin), Purity: By HPLC >/= 95%,residues 1 to 21 phosphorylated at Ser-10, Molecular Weight: 2845.3, Size: 0.25 mg

Catalog Number: 103007-996

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous Rh110 Caspase-3/7 Assay Kit, Components: Rh110 Caspase-3/7 substrate 250 ul, Rh110 1 mM DMSO solution, 40 ul, Ac-DEVD-CHO 5 mM DMSO solution, 10 ul, Assay buffer 30 mL, DTT 1 M, 1.1 mL, 10X Lysis Buffer 20 mL

Catalog Number: 103010-170

Supplier: Anaspec Inc

Sale

Description: TAT (47-57), FAM-labeled fluorescent, Absorbance /Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-YGRKKRRQRRR, Molecular Weight: 1918.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-418

Supplier: Anaspec Inc

Sale

Description: T20 36-residue peptide corresponds to aa 643-678 of the C-terminus of HIV-1LAIgp41. It strongly inhibits HIV-1 viral fusion with an EC50 of 1 ng/ml, Purity: HPLC>/=95%, Sequence (One-Letter Code): Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2, Molecular weight: 4492, Size: 1 mg

Catalog Number: 103006-446

Supplier: Anaspec Inc

Sale

Description: Smac/Diablo Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1555.8, Sequence: AVPIAQKSEK-K(5-FAM)-NH2, Label: 5-FAM labeled, Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-434

Supplier: Anaspec Inc

Sale