You Searched For: Anaspec Inc


1,262  results were found

Sort Results

List View Easy View
SearchResultCount:"1262"
Description: SensoLyte* ONPG B-Galactosidase Assay Kit *Colorimetric*, Components: Substrate solution 50 mL, B -galactosidase enzyme 0.1 mg/mL, 20 uL, Lysis buffer 100 mL, Stop solution 30 mL, DTT 1 M, 5 mL, Optimized Performance, Enhanced Value, Assured Reliability
Catalog Number: 103010-474
Supplier: Anaspec Inc


Description: Rat Atrial Natriuretic Peptide (4-18)
Catalog Number: 103006-666
Supplier: Anaspec Inc


Description: S3 Fragment, ADF/cofilin
Catalog Number: 103007-442
Supplier: Anaspec Inc


Description: Histone H4 (1-21)-Lys(Biotin), Sequence: Ac-SGRGKGGKGLGKGGAKRHRKVGG-K(Biotin), Purity: By HPLC greater than or equal to 95%, This sequence is amino acids 1 to 21 fragment of the histone 4, Molecular Weight: 2602.1, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-396
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-990
Supplier: Anaspec Inc


Description: 5 - FAM MMP FRET Peptide Fluorescence Standard I, Purity: % Peak Area By HPLC >/= 95%, Sequence(One-Letter Code): 5-FAM-PL, Sequence (Three-Letter Code): 5 - FAM - Pro - Leu - OH, Storage: -20 deg C, Size: 0.1mg
Catalog Number: 103005-948
Supplier: Anaspec Inc


Description: [Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-544
Supplier: Anaspec Inc


Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 25 mg
Catalog Number: 102996-498
Supplier: Anaspec Inc


Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 0.1mg
Catalog Number: 103002-974
Supplier: Anaspec Inc


Description: Cell Adhesive Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 449.5, Sequence: RGDC, capable of binding to surface Zr alkoxide complexes through alkylcarboxylate intermediates, to stimulate human osteoblast attachment, Storage: -20 deg C, Size: 1mg
Catalog Number: 103008-600
Supplier: Anaspec Inc


Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-586
Supplier: Anaspec Inc


Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-804
Supplier: Anaspec Inc


Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-104
Supplier: Anaspec Inc


Description: RS domain derived peptide peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GRSRSRSRSR, Molecular weight: 1204.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-942
Supplier: Anaspec Inc


Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-412
Supplier: Anaspec Inc


Description: Syntide-2, Purity: HPLC >/= to 95%, Molecular Weight: 1507.9, Sequence: H-Pro-Leu-Ala-Arg-Thr-Leu-Ser-Val-Ala-Gly-Leu-Pro-Gly-Lys-Lys-OH, Appearance: solid, is a selective substrate for CaM kinase II and protein kinase C, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-268
Supplier: Anaspec Inc


321 - 336 of 1,262