You Searched For: Anaspec Inc

Description: CREBtide, FAM (Carboxyfluorescein)

Catalog Number: 103003-138

Supplier: Anaspec Inc

Sale

Description: HIV TAT Cys(Npys)

Catalog Number: 103006-426

Supplier: Anaspec Inc

Sale

Description: Human Ang II Peptide

Catalog Number: 102996-068

Supplier: Anaspec Inc

Sale

Description: Bid BH3-r8

Catalog Number: 103006-928

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ONPG B-Galactosidase Assay Kit *Colorimetric*, Components: Substrate solution 50 mL, B -galactosidase enzyme 0.1 mg/mL, 20 uL, Lysis buffer 100 mL, Stop solution 30 mL, DTT 1 M, 5 mL, Optimized Performance, Enhanced Value, Assured Reliability

Catalog Number: 103010-474

Supplier: Anaspec Inc

Sale

Description: Rat Atrial Natriuretic Peptide (4-18)

Catalog Number: 103006-666

Supplier: Anaspec Inc

Sale

Description: S3 Fragment, ADF/cofilin

Catalog Number: 103007-442

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-21)-Lys(Biotin), Sequence: Ac-SGRGKGGKGLGKGGAKRHRKVGG-K(Biotin), Purity: By HPLC greater than or equal to 95%, This sequence is amino acids 1 to 21 fragment of the histone 4, Molecular Weight: 2602.1, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-396

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-15), Human, Purity: HPLC >/= 95%, Sequence (1-Letter Code): DAEFRHDSGYEVHHQ, Sequence (3-Letter Code): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH, Molecular weight: 1826.9, Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-990

Supplier: Anaspec Inc

Sale

Description: 5 - FAM MMP FRET Peptide Fluorescence Standard I, Purity: % Peak Area By HPLC >/= 95%, Sequence(One-Letter Code): 5-FAM-PL, Sequence (Three-Letter Code): 5 - FAM - Pro - Leu - OH, Storage: -20 deg C, Size: 0.1mg

Catalog Number: 103005-948

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-544

Supplier: Anaspec Inc

Sale

Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-498

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (5-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 4051.6, Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Storage: At -20 Degree C, Size: 0.1mg

Catalog Number: 103002-974

Supplier: Anaspec Inc

Sale

Description: Cell Adhesive Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 449.5, Sequence: RGDC, capable of binding to surface Zr alkoxide complexes through alkylcarboxylate intermediates, to stimulate human osteoblast attachment, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-600

Supplier: Anaspec Inc

Sale

Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-586

Supplier: Anaspec Inc

Sale

Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-804

Supplier: Anaspec Inc

Sale