You Searched For: Thermostat+Controllers


2,051  results were found

SearchResultCount:"2051"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103007-320)
Supplier: Anaspec Inc
Description: p53 (17 - 26), FITC labeled, Sequence: FITC - LC - ETFSDLWKLL - NH2, Purity: By HPLC greater than or equal to 95%, This is amino acids 17 to 26 fragment of p53, fluorescent labeled through an LC spacer, Molecular Weight: 1753.1, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-760)
Supplier: Anaspec Inc
Description: SV-40 Large T-antigen Nuclear Localization Signal (NLS), Sequence: CGGGPKKKRKVED, Purity: By HPLC greater than or equal to 95%, derived from Large T antigen residue 47 to 55, Molecular Weight: 1401.7, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-394)
Supplier: Anaspec Inc
Description: Myosin H Chain Fragment, mouse, Sequence: Ac-RSLKLMATLFSTYASADR, Purity: By HPLC >/= 95%, This peptide is a fragment of the murine heart muscle specific peptide derived from a-myosin H chain, Molecular Weight: 2073.4, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-982)
Supplier: Anaspec Inc
Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 1 mg


Catalog Number: (103006-240)
Supplier: Anaspec Inc
Description: Histatin - 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): DSHAKRHHGYKRKFHEKHHSHRGY, Molecular Weight: 3036.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103008-180)
Supplier: Anaspec Inc
Description: Histone H3 (21-44), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2505.9, Sequence: ATKAARKSAPATGGVKKPHRYRPG, derived from Histone H3 21-44 amino acids, used as a substrate for protein arginine methyltransferases, Storage: -20 degree C, Size: 1mg


Catalog Number: (103008-084)
Supplier: Anaspec Inc
Description: Plasmodium falciparum Plasmodium falciparum Circumsporozoite Protein, (6NANP) PfCSP, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2499.6, Sequence: NANPNANPNANPNANPNANPNANPC, Storage: -20 degree C, Size: 1mg


Catalog Number: (103005-956)
Supplier: Anaspec Inc
Description: Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 5mg


Catalog Number: (103007-506)
Supplier: Anaspec Inc
Description: Histone H3 (1-20), N-Terminal, Sequence: ARTKQTARKSTGGKAPRKQL, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 20 fragment of the histone H3, Molecular Weight: 2183.6, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103000-622)
Supplier: Anaspec Inc
Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103008-474)
Supplier: Anaspec Inc
Description: Temporin A, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1396.8, Sequence: FLPLIGRVLSGIL-NH2, Appearance: Solid, highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria (inducing the migration), Storage: -20 degree C, Size: 1mg


Catalog Number: (103006-480)
Supplier: Anaspec Inc
Description: Pep-1: Chariot (Non-Covalent Delivery of Peptides and Proteins) peptide carrier for the noncovalent delivery of proteins into cells, Purity: HPLC>/=95%, Sequence (One-Letter Code): KETWWETWWTEWSQPKKKRKV, MW: 2848.3, Size: 1 mg


Catalog Number: (103007-446)
Supplier: Anaspec Inc
Description: 37, 40 GAP26, Connexin Mimetic, Sequence: VCYDQAFPISHIR, Purity: By HPLC >/= 95%, This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins, Molecular Weight: 1548.8, Apperance: powder, Storage: -20 C, Size: 1 mg


Catalog Number: (103007-452)
Supplier: Anaspec Inc
Description: 43Gap 26, Connexin Mimetic, Sequence: VCYDKSFPISHVR, Purity: By HPLC greater than or equal to 95%, Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43, Molecular Weight: 1550.8, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103010-472)
Supplier: Anaspec Inc
Description: SensoLyte* FDG B-Galactosidase Assay Kit *Fluorimetric*, Components: B-galactosidase substrate 10 mM, 250 uL, Fluorescein 2 mM, 25 uL, B-galactosidase enzyme 0.1 mg/mL, 20 uL, Assay buffer 100 mL, DTT 1 M, 4.5 mL, Triton X-100 200 uL, Stop solution 30 mL


Catalog Number: (103003-158)
Supplier: Anaspec Inc
Description: Adrenomedullin (1-50), rat, Purity: HPLC >/- 95%, Molecular Weight: 5729.5, Sequence: YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2, Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent, Storage: -20 deg C, Size: 0.5 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
401 - 416 of 2,051
no targeter for Bottom