You Searched For: Anaspec Inc

Description: Kallikrein 3 Substrate

Catalog Number: 103003-896

Supplier: Anaspec Inc

Sale

Description: 4N1K, AnaSpec

Catalog Number: 103008-256

Supplier: Anaspec Inc

Sale

Description: Thrombin Substrate

Catalog Number: 103007-720

Supplier: Anaspec Inc

Sale

Description: ARP

Catalog Number: 103003-296

Supplier: Anaspec Inc

Sale

Description: Insulin Receptor (1142-1153)

Catalog Number: 102998-160

Supplier: Anaspec Inc

Sale

Description: [Gla17,21,24] - Osteocalcin (1 - 49), YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELADHIGFQEAYRRFYGPV (Gla=Y - Carboxyglutamic Acid, Disulfide bridge: 23 - 29), Molecular Weight: 5929.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-358

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled, Sequence: ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 di-methylated at Lys-9, Molecular Weight: 2751.2, Size: 1 mg

Catalog Number: 103007-978

Supplier: Anaspec Inc

Sale

Description: 5-TAMRA cadaverine, Synonym: Tetramethylrhodamine-5-carboxamide cadaverine, purified single isomer of 5(6)-TAMRA cadaverine mixture, for biological application, MW: 514.62, Spectral Properties: Abs/Em = 545/576 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 5 mg

Catalog Number: 103011-030

Supplier: Anaspec Inc

Sale

Description: AnaTag* AMCA - X Microscale Protein Labeling Kit *Ultra Convenient* Components: AMCA-X SE 3 vials, Reaction buffer 0.5 Ml, Spin column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 ml, Wash tube/Collect tube: 3 tubes, storage: 4 deg C

Catalog Number: 103010-368

Supplier: Anaspec Inc

Sale

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-416

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAARKSAPATGGV-K(Ac)-KPHRYRPGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-596

Supplier: Anaspec Inc

Sale

Description: C34, gp41 HIV Fragment, Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL, Purity: By HPLC >/= 95%, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide, Molecular Weight: 4248.6, Apperance: Powder, Size: 1 mg

Catalog Number: 103007-194

Supplier: Anaspec Inc

Sale

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-406

Supplier: Anaspec Inc

Sale

Description: Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151), Purity %: Peak Area By HPLC >/= 95%, Molecular Weight 1862.7, Sequence(One-Letter Code): TRDI-pY-ETD-pY-pY-RK, Appearance: Lyophilized white powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-158

Supplier: Anaspec Inc

Sale

Description: AnaTag* 5 - TAMRA Microscale Protein Labeling Kit *Ultra Convenient* Components: 5-TAMRA SE 3 vials, Reaction buffer 0.5 Ml, Spin column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 ml, Wash tube/Collect tube: 3 tubes, storage: 4 deg C

Catalog Number: 103010-384

Supplier: Anaspec Inc

Sale

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-422

Supplier: Anaspec Inc

Sale