Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103007-348

Biotin - beta - Amyloid (25 - 35) 1 mg

Description: Biotin - beta - Amyloid (25 - 35), Human, mouse/rat, Sequence: Biotin - GSNKGAIIGLM, Purity: HPLC >/= 95%, This peptide is amino acids 25 to 35 fragment of the B-amyloid biotinylated at C-terminus, Molecular Weight: 1286.6, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-348
Supplier: Anaspec Inc
Image Unavailable-102996-564

Peptide YY (3-36) 1 mg

Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 1 mg
Catalog Number: 102996-564
Supplier: Anaspec Inc
Image Unavailable-103007-290

Rat Renin FRET Substrate 0.1 mg

Description: Rat Renin FRET Substrate, (5 - FAM/QXL* 520), Purity: HPLC greater than or equal to 95%, Aspartyl protease cleaves angiotensinogen to yield angiotensin I, which is further converted to angiotensin II, Molecular Weight: 2000 - 2200, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-290
Supplier: Anaspec Inc
Image Unavailable-103008-596

[Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Ac) 1mg

Description: [Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAARKSAPATGGV-K(Ac)-KPHRYRPGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-596
Supplier: Anaspec Inc
Image Unavailable-103009-972

PVEC (Cadherin-5)

Description: PVEC (Cadherin-5), Purity: HPLC >/= 95%, MW: 2209.7, Sequence: LLIILRRRIRKQAHAHSK] pVEC is a cell-penetrating peptide (CPP) that is derived from murine vascular endothelian cadherin. Apperance: Off white solid, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-972
Supplier: Anaspec Inc
Image Unavailable-103008-440

OVA (323-339) 1mg

Description: OVA (323-339), Purity: Greater than or equal to 95% (HPLC), Formula: C84H134N28O27S1, Molecular weight: 2000.2, Sequence: Biotin-ISQAVHAAHAEINEAGR, Label: Biotin, Appearance: Powder, N-terminal OVA Peptide, amino acids 323 to 339, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-440
Supplier: Anaspec Inc
Image Unavailable-103007-194

C34, gp41 HIV Fragment 1 mg

Description: C34, gp41 HIV Fragment, Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL, Purity: By HPLC >/= 95%, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide, Molecular Weight: 4248.6, Apperance: Powder, Size: 1 mg
Catalog Number: 103007-194
Supplier: Anaspec Inc
Image Unavailable-102997-152

CEF8, Influenza Virus NP (383 - 391) 1 mg

Description: CEF8, Influenza Virus NP (383 - 391), SRYWAIRTR, HLA-B*3501 restricted influenza virus nucleoprotein epitope, Sequence (Three-Letter Code) H - Ser - Arg - Tyr - Trp - Ala - Ile - Arg - Thr - Arg - OH, MW: 1208.4, Physical State: Solid, at-20deg C, Size: 1mg
Catalog Number: 102997-152
Supplier: Anaspec Inc
Image Unavailable-103003-406

Glucagon (1-37) Oxyntomodulin 1 mg

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-406
Supplier: Anaspec Inc
Image Unavailable-102998-158

Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151) 1mg

Description: Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151), Purity %: Peak Area By HPLC >/= 95%, Molecular Weight 1862.7, Sequence(One-Letter Code): TRDI-pY-ETD-pY-pY-RK, Appearance: Lyophilized white powder, Storage -20 deg C, Size: 1mg
Catalog Number: 102998-158
Supplier: Anaspec Inc
Image Unavailable-103010-462

SensoLyte* Luminescent Peroxidase Assay Kit

Description: SensoLyte* Luminescent Peroxidase Assay Kit *Luminometric*, Components: Substrate A 15 mL, Substrate B 15 mL, Peroxidase (Horseradish Peroxidase) standard 10 ug/mL, 100 ul, Assay buffer 60 mL, Optimized Performance, Enhanced Value, Assured Reliability
Catalog Number: 103010-462
Supplier: Anaspec Inc
Image Unavailable-103007-602

[Arg6]-beta-Amyloid (1-40) English Mutation 0.5 mg

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4348.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-602
Supplier: Anaspec Inc
Image Unavailable-103007-786

gp91 ds-tat Peptide 2, sgp91 ds-tat Peptide 2 scrambled 1 mg

Description: gp91 ds-tat Peptide 2, sgp91 ds-tat Peptide 2, scrambled, Sequence: RKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC >/= 95%, peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor, Molecular Weight: 2453, Size: 1 mg
Catalog Number: 103007-786
Supplier: Anaspec Inc
Image Unavailable-103003-194

5-FAM-PLSRTLSVSS-NH2 1mg

Description: 5-FAM-PLSRTLSVSS-NH2, Purity: HPLC >/- 95%, Molecular Weight: 1403.5, Storage -20 deg C, Size 1 mg
Catalog Number: 103003-194
Supplier: Anaspec Inc
Image Unavailable-103007-156

2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL 1 mg

Description: 2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL, Sequence: EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH, Purity: By HPLC >/= 95%, Molecular Weight: 1896, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-156
Supplier: Anaspec Inc
Image Unavailable-103010-222

QXL* 490 acid 10 mg

Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 10 mg
Catalog Number: 103010-222
Supplier: Anaspec Inc
225 - 240 of 1,262