You Searched For: Anaspec Inc

Description: [Arg(Me2s)8]-Histone H3 (1-21), Purity: HPLC >/= 95%, MW: 2637.1, Sequence: [ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)] dimethylated at Arg8 with a methyl group added, to each nitrogen of the guanidinium group. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-906

Supplier: Anaspec Inc

Sale

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 1 g

Catalog Number: 103010-838

Supplier: Anaspec Inc

Sale

Description: Neutrophil elastase Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: 102996-448

Supplier: Anaspec Inc

Sale

Description: CEF Control Peptide Pool

Catalog Number: 103006-274

Supplier: Anaspec Inc

Sale

Description: AnaTag™ B-PE Labeling Kit

Catalog Number: 103010-182

Supplier: Anaspec Inc

Sale

Description: MUC1

Catalog Number: 103003-254

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AFC Urokinase (uPA) Activity Assay Kit *Fluorimetric*, Components: GSH detection reagent 1 vial, Reduced Glutathione standard 10 mM, 100 ul, Assay Buffer 50 mL, GST enzyme 50U/mL, 200 uL, DMSO 100 uL, storage: -20 deg C

Catalog Number: 103010-522

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44)-GK, Biotin

Catalog Number: 103008-158

Supplier: Anaspec Inc

Sale

Description: Human;Mouse;Rat Beta-Amyloid (17-40)

Catalog Number: 102999-342

Supplier: Anaspec Inc

Sale

Description: Bovine P2 (53-78)

Catalog Number: 103009-986

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103003-042

Supplier: Anaspec Inc

Sale

Description: Insulin B (9-23) insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): SHLVEALYLVCGERG, Molecular Weight: 1645.9, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-812

Supplier: Anaspec Inc

Sale

Description: Fluorescein biotin [[5-((N-(5-(N-(6-(Biotinoyl)amino)hexanoyl)amino)pentyl)thioureidyl) fluorescein]], Molecular Weight: 831, Appearance: solid, Solvent System: DMSO or DMF, Green fluorescent biotin used for studying avidin binding, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-306

Supplier: Anaspec Inc

Sale

Description: [Lys22] - beta - Amyloid (1 - 42), Italian Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, lysine substituted for glutamic acid at position 22, Molecular Weight: 4513.2, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-216

Supplier: Anaspec Inc

Sale

Description: Cyclo[ - RGDy - K(5 - FAM)], Purity: Greater than or equal to 95% (HPLC), Molecular weight: 978, Sequence: Cyclo[ - RGDy - K(5 - FAM)], peptide is a 5-FAM-labeled cylic RGDyK peptide, serve as ligands for av-integrin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-020

Supplier: Anaspec Inc

Sale

Description: EndoFree Recombinant Human alpha-Synuclein Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, Thioflavin T assay, Application: Fibrillation, oligomerization, cell toxicity studies, Storage: 2-4 degree C, Size: 100ug

Catalog Number: 103001-642

Supplier: Anaspec Inc

Sale