You Searched For: Anaspec Inc

Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale

Description: Ala - Y - D - Glu - DAP, Purity: >/= 95%, MW: 390.4, Sequence: (One-Letter Code): A-(Y-e)-DAPwith the diaminopimelic acid coupled to the Y-carboxylic acid of the D-isomer of Glu, Appearance: Lyophilized white solid, Storage: -20 degree Celcius, Size: 1 mg

Catalog Number: 103005-974

Supplier: Anaspec Inc

Sale

Description: Peptide Substrate for Renin 520 Assay kit, Purity: HPLC greater than or equal to 95%, Molecular Weight: 2000 - 2200, Appearance: Lyophilized red powder, for screening of renin inhibitors, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103007-076

Supplier: Anaspec Inc

Sale

Description: 5-FAM, SE, Synonym: 5-Carboxyfluorescein, succinimidyl ester; 5-FAM, NHS ester, Molecular Weight 473.39, Molecular Formula: C25H15NO9, Appearance: Orange solid, Purity: >90% (TLC), >90% (HPLC), Spectral Properties: Abs/Em = 492/518 nm, Solvent System: DMF or DMSO, Size: 100 mg

Catalog Number: 103010-776

Supplier: Anaspec Inc

Sale

Description: Src Optimal Peptide Substrate, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1799, Sequence: AEEEIYGEFEAKKKK, Identified as a Src optimal peptide substrate, used to measure the wild type Src activity, Storage: At -20 degree C, Size: 1mg

Catalog Number: 103003-006

Supplier: Anaspec Inc

Sale

Description: HIV Protease FRET Substrate I, Purity: HPLC >/= 95%, Molecular Weight: 1532.5, Sequence: DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS, Appearance: Lyophilized red powder, It is widely used for the continuous assay for HIV protease activity, Size: 1 mg

Catalog Number: 102996-366

Supplier: Anaspec Inc

Sale

Description: 4 - Nitrophenyl - N - acetyl - b - D - galactosaminide, Chromogenic N-acetylgalactosaminidase substrate, Molecular Weight 342.31, Spectral Properties Abs/Em = 399/NA nm, Solvent System DMSO, CAS: 14948-96-0, MF: C14H18N2O8, Size: 100 mg

Catalog Number: 103011-316

Supplier: Anaspec Inc

Sale

Description: Staphylococcal Enterotoxin B Domain (SEB) (144-153), Sequence: KKKVTAQELD, Purity: By HPLC >/= 95%, peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172, Molecular Weight: 1159.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-764

Supplier: Anaspec Inc

Sale

Description: [Cys(HiLyte* Fluor 647 C2 maleimide)]-Exendin-4, Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, HiLyte Fluor 647 labeled Extendin-4, Molecular Weight: 5486.3, Size: 50 ug

Catalog Number: 103007-522

Supplier: Anaspec Inc

Sale

Description: Autocamtide-3 Derived Inhibitory Peptide(AC3-I); CaMKII Inhibitor, myristoylated, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1689.1, Sequence: Myr-KKALHRQEAVDAL, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-590

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-4, amide MW: 739.8, Sequence: trans-Cinnamoyl-YPGKF-NH2] This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation, Store: -20 deg C, Size: 1mg

Catalog Number: 103010-030

Supplier: Anaspec Inc

Sale

Description: ClearPoint* beta-Amyloid (1-40), 13C, 15N - labeled at Arg & Lys, Human, Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV, Purity: By HPLC >/= 95%, All Arginine and Lysines have universally labeled, Molecular Weight: 4355.9, Size: 50 ug

Catalog Number: 103007-698

Supplier: Anaspec Inc

Sale

Description: Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain, Sequence: HDAPIGYD, Purity: HPLC >/= 95%, e-PKC specific activator, it also activates MARCKS phosphorylation, Molecular Weight: 886.9, Size: 1 mg

Catalog Number: 103007-230

Supplier: Anaspec Inc

Sale

Description: Methoxyresorufin Synonym: Resorufin methyl ether, Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavag, Molecular Weight: 227.2, Spectral Properties: Abs/Em = 571/585 nm, Solvent System: DMSO, Storage -20 degree C, Size: 5 mg

Catalog Number: 103011-332

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (12-28), Human, Purity: HPLC >/= 95%, Molecular Weight: 1955.2, Sequence: H-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-OH, Appearance: Lyophilized white powder, residues are the binding site for apolipoprotein E, Size: 1mg

Catalog Number: 102996-482

Supplier: Anaspec Inc

Sale

Description: Streptavidin, Recombinant, Streptavidin is a nonglycosylated tetrameric protein that binds biotin noncovalently and with high affinity, was expressed in E. Coli, It shows one major band about 56 kDa on SDS-PAGE, Apperance: Lyophilized powder, size: 1000 mg

Catalog Number: 103010-560

Supplier: Anaspec Inc

Sale