You Searched For: Anaspec Inc

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-412

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2636.1, Sequence: ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-616

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, Purity: HPLC >/= to 95%, Molecular Weight: 2850.3, Sequence: FAM-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-OH, label: FAM, Appearance: Solid, This is a fluorescent labeled peptide, Abs/Em = 494/521 nm, Size: 0.5 mg

Catalog Number: 102996-804

Supplier: Anaspec Inc

Sale

Description: RS domain derived peptide peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GRSRSRSRSR, Molecular weight: 1204.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-942

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-104

Supplier: Anaspec Inc

Sale

Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-804

Supplier: Anaspec Inc

Sale

Description: 5-FAM cadaverine, Synonym: Fluorescein-5-carboxamide cadaverine, building block to prepare fluorescent ligands for receptor binding assays, Molecular Weight: 460.48, Spectral Properties: Abs/Em = 494/521 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 10 mg

Catalog Number: 103011-020

Supplier: Anaspec Inc

Sale

Description: Pentoxyresorufin, Synonym: Resorufin pentyl ether, Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage, MW: 283.33, Molecular Formula: C17H17NO3, Spectral Properties: Abs/Em = 571/585 nm, Solvent System: DMSO, Size: 5 mg

Catalog Number: 103011-356

Supplier: Anaspec Inc

Sale

Description: Hoechst 33342, 20 mM solution in water, Cell-permeant DNA minor groove binding dye, Molecular Weight: 561.93, Spectral Properties: Abs/Em = 350/461 nm, Appearance: Colorless solution, Purity: >95% (HPLC, TLC), CAS: 23491-52-3, Molecular Formula: C27H28N6O. 3HCl-xH2O, Size: 5 ml

Catalog Number: 103011-142

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Aggrecanase-1 Assay Kit *Fluorimetric*, Components: 5-FAM/5-TAMRA 60 ul, 5-FAM 1mM, 10 ul, Assay Buffer 20 Ml, Control Inhibitor 100 u
M, 10 ul, Stop Solution 10 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-186

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 750 amine, carbonyl-reactive fluorescent labeling dye, similar to Cy7 dye, MW: 1071.38, Spectral Properties: Abs/Em = 754/778 nm, Solvent System: Water, Physical State: Solid, Solubility in Water: Slightly water soluble, Storage -20 deg C, Size: 1 mg

Catalog Number: 103010-948

Supplier: Anaspec Inc

Sale

Description: Human Sirtuin 1, Recombinant, Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates, the human homolog of yeast Sir2, Storage: -80 deg C, Size: 10 ug

Catalog Number: 103010-632

Supplier: Anaspec Inc

Sale

Description: Phytochelatin 2, PC2, Purity: HPLC >/- 95%, Molecular Weight: 540.6, Sequence: H-Y-Glu-Cys-Y-Glu-Cys-Gly-OH, A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of YGlu-Cys, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-386

Supplier: Anaspec Inc

Sale

Description: Mouse Prorenin, Recombinant, Concentration: 0.5mg/ml, Renin, a protease secreted by the kidney, plays a key role in the renin-angiotensin system, acts by converting the renin substrate, angiotensinogen, to angiotensin I in the blood, Size: 20 ug

Catalog Number: 103010-552

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)12/16, Lys(Me3)20]-Histone H4 (1-25)-GSGSK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3358.8, Sequence: SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDNGSGS-K(Biotin), Storage: -20 degree C, Size: 1mg

Catalog Number: 103009-086

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ONPG B-Galactosidase Assay Kit *Colorimetric*, Components: Substrate solution 50 mL, B -galactosidase enzyme 0.1 mg/mL, 20 uL, Lysis buffer 100 mL, Stop solution 30 mL, DTT 1 M, 5 mL, Optimized Performance, Enhanced Value, Assured Reliability

Catalog Number: 103010-474

Supplier: Anaspec Inc

Sale