You Searched For: Anaspec Inc

Description: Syk Kinase Peptide Substrate, Sequence: KEDPDYEWPSAK-NH2, Purity: By HPLC greater than or equal to 95%, This synthetic peptide is a substrate for Syk kinase, Molecular Weight: 1463.6, Apperance: Off-White solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-866

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (3-16), human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1768.9, Sequence: EFRHDSGYEVHHQK, Appearance: Powder, peptide is amino acids 3 to 16 fragment of beta-Amyloid (AEszett) with an N-terminal deletion, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-452

Supplier: Anaspec Inc

Sale

Description: gp91 ds-tat, FAM labeled, Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2, Purity: By HPLC greater than or equal to 95%, FAM labeled peptide (Abs/Em=492/518 nm), Molecular Weight: 3031.5, Apperance: powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103007-782

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-3 (1-6), PAR-3 (1-6), human, Sequence: TFRGAP-NH2, Purity: By HPLC >/= 95%, amino acids 1 to 6 fragment of the protease-activated receptor 3 (PAR-3), Molecular Weight: 646.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-464

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - beta - Amyloid (1 - 40), Human, Purity: HPLC >/- 95%, Molecular Weight: 4669.3, Sequence: Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, This biotinylated AB contains a 6-carbon long chain to provide more accesibility, size: 0.1 mg

Catalog Number: 103003-796

Supplier: Anaspec Inc

Sale

Description: Cyclo [ - RGDyK(HiLyte* Fluor 750)], Purity: HPLC greater than or equal to 95%, Lyophilized blue powder, peptide is freely soluble in water, Molecular Weight: 1630.5, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-284

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)79]-Histone H3 (69-89), H3K79(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2877.4, Sequence: RLVREIAQDF-K(Ac)-TDLRFQSSAV-K(biotin), Label: Biotin, synthetic peptide (aa 69-89 histone H3), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-864

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2870.4, Sequence: SGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-342

Supplier: Anaspec Inc

Sale

Description: Keratin K18-C, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1418.5, Sequence: (One-Letter Code) RPVSSAApSVYAGAC
Sequence
(, corresponds to human keratin K18 amino acids 26-38, with an additional C-terminal cysteine, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103002-994

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-168

Supplier: Anaspec Inc

Sale

Description: Ghrelin, rat, mouse, Purity: HPLC >/- 95%, Molecular Weight: 3314.8, Sequence: GS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR, Rat/mouse Ghrelin differs from human Ghrelin on the 11th and 12th position-RV (Arg-Val) in rat/mouse and KA (Lys-Ala) in human, Size: 5 mg

Catalog Number: 103003-684

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2842.4, Sequence: SGRGKGGKGLGKGGAKRHR-K(Me1)-VLR-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-334

Supplier: Anaspec Inc

Sale

Description: Parathyroid Hormone (1-34)-Lys(Biotin), human, Purity: HPLC >/= 95%, Molecular Weight: 4472.2, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-410

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 488 Protein Labeling Kit [3 labeling reactions (3 x 5 mg protein)], HiLyte Fluor*488 SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 1 mL, 10X Elution buffer 30 ml, storage: 4 deg C

Catalog Number: 103010-354

Supplier: Anaspec Inc

Sale

Description: CEF19, Epstein - Barr Virus latent NA - 3A (458 - 466), HLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466), Molecular Weight: 1111.3, Sequence: YPLHEQHGM, Form: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103000-708

Supplier: Anaspec Inc

Sale

Description: Myosin Regulatory Light Chain MRCL3 (11-24), Sequence: KKRPQRATSNVFAM-NH2, Purity: By HPLC greater than or equal to 95%, This is a peptide substrate for myosin light chain kinase (MLCK), Molecular Weight: 1633, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-738

Supplier: Anaspec Inc

Sale