You Searched For: Anaspec Inc

Description: [Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 2728.2, Sequence: SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-528

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 10 g

Catalog Number: 103010-750

Supplier: Anaspec Inc

Sale

Description: SensoLyte* NADP/NADPH Assay Kit *Colorimetric*, Components: Reagent A 180 uL, Reagent B 80 uL, Assay Buffer 50 mL, Enzyme Cycling Mix 80 uL, NADP Standard 1.5 mM, 20 uL, NADP Extraction Buffer 25 mL, NADPH Extraction Buffer 25 mL, Stop solution 20 mL

Catalog Number: 103010-618

Supplier: Anaspec Inc

Sale

Description: Kisspeptin-10 (Kp-10), Metastin (110-119), mouse, rat, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1318.5, Sequence: YNWNSFGLRY-NH2, amidated peptide sequence is found in C-terminal 110 to 119, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-422

Supplier: Anaspec Inc

Sale

Description: Resorufin B - D - Galactopyranoside, for sensitive enzyme measurements in ELISA, by flow cytometry and to detect immobilized B-galactosidase activity, Molecular Weight: 375.33, Spectral Properties: Abs/Em = 573/585 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-314

Supplier: Anaspec Inc

Sale

Description: Alpha9-Gliadin (57-68), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1455.7, Sequence: QLQPFPQPQLPY, derived from amino acid 57-68 of a9-gliadin and represents an immunodominant epitope, resistant to pancreatic proteolysis, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-718

Supplier: Anaspec Inc

Sale

Description: Dihydroethidium, Synonym: Hydroethidine, Bind to DNA/RNA (red fluorescence) upon oxidation, MW: 315.4, Spectral Properties: Abs/Em = 518/605 nm (after oxidation), Solvent System: DMSO, form: Dark red, pink Solid, Storage: -20C desiccated and protected from light, Size: 25 mg

Catalog Number: 103011-326

Supplier: Anaspec Inc

Sale

Description: B8R (20-27), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 960.1, Sequence: TSYKFESV, amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-426

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-23)-GSGSK, C-terminal, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3003.6, Sequence: SGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin), Label: Biotin, consists of amino acids 1-23 of histone H4, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-532

Supplier: Anaspec Inc

Sale

Description: Scrambled Jag1 peptide is scrambled sequence of JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): SC-Jag1, Molecular Weight: 2107.4, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-692

Supplier: Anaspec Inc

Sale

Description: Hirudin (54-65), sulfated, Sequence: Ac-GDFEEIPEE-Y(SO3H)-LQ, Purity: By HPLC greater than or equal to 95%, amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide, Molecular Weight: 1590.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-588

Supplier: Anaspec Inc

Sale

Description: Listeria monocytogenes Listeriolysin O; LLO (91-99), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1058.1, Sequence: GYKDGNEYI, peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-564

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, SE, amine-reactive fluorescent labeling dye, Synonym: HiLyte* Fluor 488 acid, NHS ester, Molecular Weight: 698.6, Spectral Properties: Abs/Em = 502/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103010-874

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Cathepsin L Assay Kit *Fluorimetric*, Components: QXL* 520/HiLyte Fluor* 488 1 mM, 50 uL, HiLyte Fluor* 488 1 mM, 10 uL, Cathepsin L, 0.1 mg/mL, 20 uL, Assay Buffer 20 mL, Cathepsin L inhibitor 100 uM, 10 uL, DTT 1 M, 200 uL, storage: -20 deg C

Catalog Number: 103010-644

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Molecular weight: 4683.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103006-504

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AMC tPA Activity Assay Kit *Fluorimetric*, Components: tPA substrate 4 mM, 50 uL, AMC 4 mM, 10 uL, 2X Assay Buffer 10 mL, Purified tPA enzyme 25 Units/uL, 40 uL, tPA Inhibitor 10 mM, 100 uL, Optimized Performance, Enhanced Value, Assured Reliability

Catalog Number: 103010-524

Supplier: Anaspec Inc

Sale