You Searched For: Labconco


8,526  results were found

SearchResultCount:"8526"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10090-028)
Supplier: Proteintech
Description: MCCC2(Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial) is also named as MCCB and belongs to the AccD/PCCB family. The putative 563-amino acid polypeptide has a calculated molecular mass of 61 kD and contains an N-terminal mitochondrial targeting sequence. It catalyzes carboxylation of 3 methylcrotonyl COA to form 3 methylglutaconyl-COA and is probably a dodecamer composed of six biotin-containing alpha subunits and six beta subunits. Defects in MCCC2 are the cause of methylcrotonoyl-CoA carboxylase 2 deficiency (MCC2D).


Supplier: Thermo Scientific Chemicals
Description: 1,1,2-Trimethyl-1H-benz[e]indole 97%
Supplier: Thermo Scientific Chemicals
Description: 2-(3-Chloro-4-fluorophenyl)indole 98%
Supplier: TCI America
Description: CAS Number: 879-37-8
MDL Number: MFCD00005641
Molecular Formula: C10H10N2O
Molecular Weight: 174.20
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Melting point (°C): 153
Supplier: TCI America
Description: CAS Number: 15861-24-2
MDL Number: MFCD00005669
Molecular Formula: C9H6N2
Molecular Weight: 142.16
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 106
Catalog Number: (10424-184)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).


Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (76078-584)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).


Catalog Number: (76078-582)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).


Catalog Number: (TCT1822-001G)
Supplier: TCI America
Description: CAS Number: 123191-00-4
MDL Number: MFCD02093498
Molecular Formula: C17H27NSi
Molecular Weight: 273.50
Purity/Analysis Method: >94.0% (GC)
Form: Clear Liquid
Color: Yellow
Specific Gravity (20/20): 0.99

SDS


Supplier: TCI America
Description: 5H-Pyrido[4,3-b]indole, Purity: >98.0%(GC), CAS Number: 244-69-9, Molecular Formula: C11H8N2, Molecular Weight: 168.20, Synonyms: Y-Carboline, Size: 1G

Supplier: Thermo Scientific Chemicals
Description: 6-(Benzyloxy)-1H-indole 97%

Catalog Number: (TCT3116-5G)
Supplier: TCI America
Description: CAS Number: 2047-91-8
MDL Number: MFCD00225387
Molecular Formula: C11H11N
Molecular Weight: 157.22
Purity/Analysis Method: >97.0% (GC)
Form: Crystal
Color: Pale Reddish Yellow
Melting point (°C): 105
Lambda max.: 230 nm (EtOH aq.)

Supplier: Thermo Scientific Chemicals
Description: Amphotericin B, antifungal activity has been used against leishmaniasis caused by protozoan parasites of the Leishmania genus.
Catalog Number: (10092-588)
Supplier: Proteintech
Description: PON1, also named as PON and K-45, belongs to the paraoxonase family. PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It can capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. PON1 may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. For glycosylated, the MW of PON1 is migrated 42-45kd. 55kd is a dimmer of isoform CRA-b. The antibody has crss-reaction to PON2 and PON3.


Catalog Number: (10751-600)
Supplier: Prosci
Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1 - 16 of 8,526
no targeter for Bottom