Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103004-224

Human MBP (87-99)

Catalog Number: (103004-224)
Supplier: Anaspec Inc
Description: This is fragment of the myelin basic protein (MBP), which corresponds to amino acids 84-96 of the murine sequence (86-98 in guinea pig; 87-99 in human).
Sequence:VHFFKNIVTPRTP
MW:1555.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-100

Human Humanin

Catalog Number: (103006-100)
Supplier: Anaspec Inc
Description: A peptide that suppresses neuronal cell death induced by the three different types (mutant amyloid precursor protein, presenilin 1, and presenilin 2) of familial Alzheimer’s Disease genes and by Aß.
Sequence:MAPRGFSCLLLLTSEIDLPVKRRA
MW:2687.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-688

Staphylococcus aureus Recombinant Protein A (from Bacteria)

Catalog Number: (103010-688)
Supplier: Anaspec Inc
Description: AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.
Image Unavailable-103009-498

[Lys(Ac)27]-Histone H3 (23-34)

Catalog Number: (103009-498)
Supplier: Anaspec Inc
Description: This is histone H3 (23-34) with acetylation at Lys27. Histone H3 acetylated at this residue is the least abundant isoform and is associated with histone deposition in replicating chromatin.
Sequence:KAAR-K(Ac)-SAPATGG
MW:1156.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-694

Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 555

Catalog Number: (103010-694)
Supplier: Anaspec Inc
Description: Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development
Image Unavailable-102996-548

[Leu5]-Enkephalin

Catalog Number: (102996-548)
Supplier: Anaspec Inc
Description: Enkephalins are pentapeptides involved in regulating nociception in the body. There are two enkephalin forms, one containing leucine and the other containing methionine ("met"). Both are products of the proenkephalin gene.
Sequence:YGGFL
MW:555.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-740

Frog Sauvagine

Catalog Number: (103003-740)
Supplier: Anaspec Inc
Description: A hypotensive and diuretic peptide. Originally isolated from the skin of the frog, Phyllomedusa sauvagei. It affects diuresis in the cardiovascular system and causes the release of ACTH and endorphins.
Sequence:Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
MW:4599.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-660

[Lys(Ac)5]-Histone H4 (1-20)

Catalog Number: (103007-660)
Supplier: Anaspec Inc
Description: This is a histone 4 peptide acetylated at lysine 5. This form of histone acetylated lysine is found to be enriched at the 5' ends of the coding regions and is known to enhance gene expression.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-080

LSKL, Inhibitor of Thrombospondin

Catalog Number: (103006-080)
Supplier: Anaspec Inc
Description: This peptide, derived from the latency-associated peptide, inhibits thrombospondin (TSP-1) activation of TGF-ß; thus preventing the progression of hepatic damage and fibrosis.
Sequence:LSKL-NH2
MW:458.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103006-054

Human sHNG

Catalog Number: (103006-054)
Supplier: Anaspec Inc
Description: A more potent suppressor of neuronal cell death than humanin (HN), 10nM of this Gly14 substituted HN blocked cytotoxicity compared to 10uM of HN.
Sequence:MAPRGFSCLLLLTGEIDLPVKRRA
MW:2657.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-612

[Lys(Me2)20]-Histone H4 (8-30)- WGK,Biotin

Catalog Number: (103009-612)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-136

CREBtide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103007-732

SAM PEP 1 Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103007-732)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-914

Histone H3 (1-25)

Catalog Number: (103006-914)
Supplier: Anaspec Inc
Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-CA10064-362

hEGF - Human Epidermal Growth Factor

Catalog Number: (CA10064-362)
Supplier: LONZA PHARMA - BIOSCIENCE CA
Description: Epidermal growth factor (EGF), is a growth factor that stimulates cell growth, proliferation, and differentiation by binding to its receptor EGFR. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds EGF results in cellular proliferation, differentiation, and survival.

Certificates


Image Unavailable-103007-672

Human Cys-LC-LL-37

Catalog Number: (103007-672)
Supplier: Anaspec Inc
Description: This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
321 - 336 of 1,860
no targeter for Bottom