You Searched For: 4-Bromo-2-nitrobenzoic+acid


36,359  results were found

SearchResultCount:"36359"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (77131-750)
Supplier: Prosci
Description: Human Recombinant BD-5 Protein (from <i>E. coli</i>)


Catalog Number: (77122-386)
Supplier: Prosci
Description: Hepatitis B Recombinant Core Protein (from <i>P. pastoris</i>)


Catalog Number: (77130-976)
Supplier: Prosci
Description: Human Recombinant S100A8 Protein (from <i>E. coli</i>)


Catalog Number: (77001-164)
Supplier: Zymo Research
Description: The Zyppy™ Plasmid Purification Kits feature a pellet-free procedure for the fastest purification of plasmid DNA.


Catalog Number: (CA82022-678)
Supplier: G-Biosciences
Description: Lipid rafts are membrane microdomains that are enriched in caveolin, cholesterol, glycolipids, sphingolipids and glycosyl-phosphatidylinositol


Catalog Number: (103010-696)
Supplier: Anaspec Inc
Description: Protein A-HiLyte™ Fluor 647 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 649 nm/674 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development


Supplier: Bachem Americas
Description: For additional products in the field of Alzheimer's disease, please see Amyloid Peptides, β-Secretase Inhibitors and Substrates and Presenilin-1 (331-349)-Cys (H-3988).

Catalog Number: (CAPI84785)
Supplier: Thermo Scientific
Description: Thermo Scientific SuperSignal Molecular Weight Protein Ladder (20 to 150K) are a ready-to-use mix of recombinant proteins with IgG-binding sites for chemiluminescent, fluorescent, chromogenic or other detection systems.

Supplier: Adipogen
Description: Cold-inducible RNA-binding protein (CIRP) is from the family of cold shock proteins that plays a protective role in the genotoxic and cold stress response. CIRBP functions as an RNA chaperone to facilitate translation and to stabilize transcripts of genes involved in cell survival. CIRP (human) is a 172-aa nuclear protein consisting of one amino-terminal consensus sequence RNA-binding domain and one carboxyl-terminal glycine-rich domain. When overexpressed, CIRP promotes assembly of stress granules (SGs). CIRP is constitutively expressed at low levels in various tissues becoming up-regulated during mild hypothermia as well as exposure to UV irradiation and hypoxia. CIRP is also found extracellularly, where it acts as a proinflammatory mediator causing deleterious effects during hemorrhagic and septic shock.

Catalog Number: (MSPP-100-1297)
Supplier: STEMCELL Technologies
Description: A member of the pentraxin family of proteins, C-reactive protein (CRP) plays important roles in host defenses, including regulating complement activation in vivo (Sjoberg <i>et al.</i>), decreasing nitric oxide production, and inhibiting angiogenesis in vitro (Verma <i>et al.</i>, 2002). At specific concentrations, CRP directly inhibits endothelial progenitor cell (EPC) differentiation, survival, and function, and is thus implicated in the development of cardiovascular diseases (Verma <i>et al.</i>, 2004). CRP is primarily synthesized by liver hepatocytes, but also by other immune cells, such as macrophages and lymphocytes (Sproston and Ashworth). The expression of this acute-phase protein is induced by IL-6 and IL-1 secretion of macrophages and T-cells during inflammation. For consistency and reproducibility across your applications, C-reactive protein from STEMCELL comes lyophilized with ≥ 87% purity, and endotoxin levels are verified to be ≤1.0 EU/μg protein.

New Product


Catalog Number: (103007-180)
Supplier: Anaspec Inc
Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: ReVacc Scientific
Description: A recombinant trimeric form of the HIV-1 glycoprotein (GP protein) from 16055 strain (clade C, GenBank: ABL67444.1) was produced by human embryonic kidney HEK293 cells, followed by Lectin purification. This product contains ectodomain of GP protein (end at D664) with furin cleavage site replaced by a linker, a I559P mutation for stable trimer formation, and C-terminal 8 hexa-histidine tag. This product has been evaluated by Size Exclusion Chromatography (SEC) to confirm the trimer formation, SDS-PAGE gel for purity and ELISAs for binding, see results. A rabbit antibody 11B that targets 241 glycan hole (BG505 specific, catalog U90R79) does not to bind to this protein (ref: Cell Rep. 2016;16(9):2327-38.).

Catalog Number: (103870-992)
Supplier: ACROBIOSYSTEMS INC MS
Description: MERS Nucleocapsid protein, His Tag, ACROBiosystems


Catalog Number: (77128-892)
Supplier: Prosci
Description: Human Recombinant FABP8 Protein (from <i>E. coli</i>)


Catalog Number: (77130-506)
Supplier: Prosci
Description: <i>T. pallidum</i> Recombinant p17 Protein (from <i>E. coli</i>)


Catalog Number: (77124-726)
Supplier: Prosci
Description: <i>T. pallidum</i> Recombinant p15 Protein (from <i>E. coli</i>)


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
433 - 448 of 36,359
no targeter for Bottom