You Searched For: Sodium+glutamate


17,901  results were found

Sort Results

List View Easy View
SearchResultCount:"17901"
Description: GAD65 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65(21-37aa ENPGTARAWCQVAQKFT), identical to the related mouse and rat sequences, Application:, IHC-P
Catalog Number: 10206-818
Supplier: Boster Biological Technology


Catalog Number: 10374-570
Supplier: Bioss


Description: GLS2 antibody, Polyclonal, Host: Rabbit, , Isotype: IgG, Immunogen: GLS2 antibody was raised against an 18 amino acid synthetic peptide near the center terminus of human GLS2, Tested applications: ELISA, IF, IHC, WB
Catalog Number: 10751-254
Supplier: Prosci


Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IHC-P, 100ul
Catalog Number: 10447-378
Supplier: Bioss


Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Dog, Zebrafish, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human ALDH4A1. purified by protein A chromatography method. Application: E, WB, IHC
Catalog Number: 10109-458
Supplier: Prosci


Description: VGLUT2 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Application: WB, IHC-P, IF, Conjugate: Alexa Fluor 750, Source: KLH conjugated synthetic peptide derived from human VGLUT2 Synonyms: VGLUT 2, VGluT2, Size: 100ul
Catalog Number: 76111-068
Supplier: Bioss


Catalog Number: 77437-302
Supplier: Bioss


Catalog Number: I-1180.0250BA
Supplier: Bachem Americas


Description: Polyclonal antibody NMDAR1 (phospho Ser896) Host: Rabbit Species reactivity: Human, Mouse, Rat immunogen: raised against a peptide sequence around phosphorylation site of serine 896 (R-R-S (p) -S-K) derived from Human NMDAR1. Tested application: WB, IHC, IF
Catalog Number: 10070-330
Supplier: Prosci


Catalog Number: 77439-910
Supplier: Bioss


Description: GCLC polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GCLC(7-24aa GSPLSWEETKRHADHVRR), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10209-754
Supplier: Boster Biological Technology


Description: Biotin-Gastrin (1-17),Biotin
Catalog Number: 103003-130
Supplier: Anaspec Inc


Description: [Lys22] - beta - Amyloid (1 - 42), Italian Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, lysine substituted for glutamic acid at position 22, Molecular Weight: 4513.2, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-216
Supplier: Anaspec Inc


Description: NQO1 Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DTD; QR1; DHQU; DIA4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10325-666
Supplier: Bioss


Description: , 59-30-3, C19H19N7O6, 441.40
Catalog Number: TCF0043-025G
Supplier: TCI America

Description: NQO1 Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DTD; QR1; DHQU; DIA4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10325-668
Supplier: Bioss


785 - 800 of 17,901