Print…

You Searched For: Sodium+glutamate


17,901  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"17901"

Rate These Search Results

Image Unavailable-89322-922

Rabbit Polyclonal antibody to KA1 (glutamate receptor, ionotropic, kainate 4)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89322-922
Supplier: Genetex
Image Unavailable-89295-964

GT PAB to GRIN3B

Description: Goat Polyclonal antibody to GRIN3B (glutamate receptor ionotropic N-methyl-D-aspartate 3B) Purity: Antigen affinity chromatography. Species Reactivity: Human Tested Applications: ELISA WB Pkg Size: 100 ug
Catalog Number: 89295-964
Supplier: Genetex
Image Unavailable-103007-114

[Gly22] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc
Image Unavailable-10795-322

Antibody

Description: MGluR8, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide of human GRM8, Synonymns: GRM8, GLUR8, glutamate receptor, metabotropic 8, mGlu8, MGLUR8, GPRC1H Antibody, Application: IHC, IHC-P, WB, Size: 100UG
Catalog Number: 10795-322
Supplier: Genetex
Image Unavailable-76116-452

LGI1 Polyclonal Antibody 100ul

Description: LGI1 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Source: KLH conjugated synthetic peptide derived from human LGI1 Synonyms: Epitempin-1, EPT, ETL1, IB1099, Application: IHC-P, IF(IHC-P), Size: 100ul
Catalog Number: 76116-452
Supplier: Bioss
Image Unavailable-89268-810

RB PAB to SH3BGRL

Description: Rabbit Polyclonal antibody to SH3BGRL (SH3 domain binding glutamic acid-rich protein like) Purity: Peptide Affinity Purified Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 50 ug
Catalog Number: 89268-810
Supplier: Genetex
Product Image-BDH4574-500G

Sodium nitrate ≥99.0%, crystallised ACS, VWR Chemicals BDH®

Description: Sodium nitrate ≥99.0%, crystallised ACS, VWR Chemicals BDH®
Catalog Number: BDH4574-500G
Supplier: VWR International

SDS Certificates


Image Unavailable-89304-806

RB PAB to NMDAR1

Description: Rabbit Polyclonal antibody to NMDAR1 (glutamate receptor ionotropic N-methyl D-aspartate 1) Purity: Antibodies were purified by affinity-chromatography using epitope-specific peptide. Species Reactivity: Human Mouse Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89304-806
Supplier: Genetex
Image Unavailable-89297-808

GT PAB to GAD2 / GAD65

Description: Goat Polyclonal antibody to GAD2 / GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain 65kDa)) Purity: Antigen affinity chromatography. Species Reactivity: Human Mouse Dog Rat Tested Applications: ELISA WB Pkg Size: 100ug
Catalog Number: 89297-808
Supplier: Genetex
Image Unavailable-10369-874

NMDAR1 SER896 ANTIBODY

Catalog Number: 10369-874
Supplier: Bioss
Image Unavailable-10087-302

Anti-GAD2

Description: Anti-GAD2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Peptide, Peptide with Sequence CLRTLEDNEERMSRLSKVA, Format:Antigen affinity purification, Application: ELISA, WB, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10087-302
Supplier: Proteintech
Image Unavailable-89284-092

RB PAB to GLUR1-SUBUNIT (S831)

Description: Rabbit Polyclonal antibody to GluR1-Subunit (phospho Ser831) (glutamate receptor ionotropic AMPA 1) Purity: Affinity Purified Species Reactivity: Rat Tested Applications: WB Pkg Size: 150 ul
Catalog Number: 89284-092
Supplier: Genetex
Image Unavailable-89306-600

Rabbit Polyclonal antibody to GluR1 (Phospho Ser836) (glutamate receptor, ionotropic, AMPA 1)

Description: Purity: affinity-chromatography using epitope-specific phosphopeptide. Species Reactivity: Human, Mouse, Rat Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89306-600
Supplier: Genetex
Image Unavailable-89283-834

RB PAB to NMDAR2B (Y1252)

Description: Rabbit Polyclonal antibody to NDMAR2B (phospho Tyr1252) (glutamate receptor ionotropic N-methyl D-aspartate 2B) Purity: Affinity Purified Species Reactivity: Rat Tested Applications: IHC WB Pkg Size: 100 ul
Catalog Number: 89283-834
Supplier: Genetex
Image Unavailable-89284-040

RB PAB to NMDAR2C (S1096)

Description: Rabbit Polyclonal antibody to NDMAR2C (phospho Ser1096) (glutamate receptor ionotropic N-methyl D-aspartate 2C) Purity: Affinity Purified Species Reactivity: Mouse Rat Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89284-040
Supplier: Genetex
Image Unavailable-89284-042

RB PAB to NMDAR2C

Description: Rabbit Polyclonal antibody to NDMAR2C (glutamate receptor ionotropic N-methyl D-aspartate 2C) Purity: Affinity Purified Species Reactivity: Human Mouse Rat Tested Applications: IHC IP WB Pkg Size: 100 ul
Catalog Number: 89284-042
Supplier: Genetex
1,025 - 1,040 of 17,901