Print…

You Searched For: ZnAF-1+DA


93,406  results were found

Refine Results Sort by
SearchResultCount:"93406"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103008-426

Vaccinia Virus B8R (20-27)

Catalog Number: (103008-426)
Supplier: Anaspec Inc
Description: This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-694

Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 555

Catalog Number: (103010-694)
Supplier: Anaspec Inc
Description: Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development
Image Unavailable-103000-576

HIV TAT (47-57) FITC LC Peptide, FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc
Description: This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Image Unavailable-103003-740

Frog Sauvagine

Catalog Number: (103003-740)
Supplier: Anaspec Inc
Description: A hypotensive and diuretic peptide. Originally isolated from the skin of the frog, Phyllomedusa sauvagei. It affects diuresis in the cardiovascular system and causes the release of ACTH and endorphins.
Sequence:Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
MW:4599.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-548

[Leu5]-Enkephalin

Catalog Number: (102996-548)
Supplier: Anaspec Inc
Description: Enkephalins are pentapeptides involved in regulating nociception in the body. There are two enkephalin forms, one containing leucine and the other containing methionine ("met"). Both are products of the proenkephalin gene.
Sequence:YGGFL
MW:555.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-732

SAM PEP 1 Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103007-732)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-600

Cell Adhesive Peptide [RGDC]

Catalog Number: (103008-600)
Supplier: Anaspec Inc
Description: This is a cell adhesive peptide (RGDC), capable of binding to surface Zr alkoxide complexes through (maleimido) alkylcarboxylate intermediates. This peptide may be used to stimulate human osteoblast attachment.
Sequence:RGDC
MW:449.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-646

Histone H2A (1-20)

Catalog Number: (103007-646)
Supplier: Anaspec Inc
Description: This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-364

[Lys0]-Bradykinin (Kallidin)

Catalog Number: (102999-364)
Supplier: Anaspec Inc
Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-738

Myosin Regulatory Light Chain MRCL3 (11-24)

Catalog Number: (103007-738)
Supplier: Anaspec Inc
Description: This is a peptide substrate for myosin light chain kinase (MLCK). The sequence is derived from amino acid residues 11-24 of human myosin regulatory light chain MRCL3.
Sequence:KKRPQRATSNVFAM-NH2
MW:1633 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-638

Human [Cys26]-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103007-400

Chicken OVA (257-264)

Catalog Number: (103007-400)
Supplier: Anaspec Inc
Description: This octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, presented by the class I MHC molecule, H-2Kb.
Sequence: SIINFEKL-NH2
MW: 962.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103008-468

Human Endothelin 1, HiLyte™ Fluor 488

Catalog Number: (103008-468)
Supplier: Anaspec Inc
Description: This is a fluorescent (HiLyte™ Fluor 488)-labeled Endothelin 1 (ET-1) peptide, Abs/Em=503/528 nm.
Sequence:HiLyte™ Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 and 3-11)
MW:2848.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-758

Histone H3 (1-21), K4 Methylated, FAM (Carboxyfluorescein)

Catalog Number: (103007-758)
Supplier: Anaspec Inc
Description: This is a FAM (Abs/Em = 492/518 nm) labeled histone 3 (H3) amino acid residues 1 to 21 with lysine 4 methylated.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2868.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-136

Human Beta-Amyloid (1-15)-Lys16, HiLyte™ Fluor 488

Catalog Number: (103007-136)
Supplier: Anaspec Inc
Description: This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-464

Tyrosinase-Related Protein 2 (181-188)

Catalog Number: (103008-464)
Supplier: Anaspec Inc
Description: This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 181-188, and has been identified as the primary epitope of TRP2 recognized by anti-B16 melanoma cytotoxic T lymphocytes (CTLs).
Sequence:VYDFFVWL
MW:1088.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
369 - 384 of 93,406
no targeter for Bottom