Print…

You Searched For: Rink+amide+AM+resin


13,527  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"13527"

Rate These Search Results

Product Image-62400-336

Safe-Grind* Plastic-Coated Tissue Grinders with Fluoropolymer Resin Pestle

Description: Heavy, clear plastic coating on Potter-Elvehjem style tissue grinders protects mortar from scratches and provides surer grip. Coating contains glass and homogenate if breakage occurs. Transparent coating. Autoclavable. 15mL.
Catalog Number: 62400-336
Supplier: DWK Life Sciences (KIMBLE)

Small Business Enterprise


Product Image-62400-347

Safe-Grind* Plastic-Coated Tissue Grinders with Fluoropolymer Resin Pestle

Description: Heavy, clear plastic coating on Potter-Elvehjem style tissue grinders protects mortar from scratches and provides surer grip. Coating contains glass and homogenate if breakage occurs. Transparent coating. Autoclavable. 30mL.
Catalog Number: 62400-347
Supplier: DWK Life Sciences (KIMBLE)

Small Business Enterprise


Product Image-62400-325

Safe-Grind* Plastic-Coated Tissue Grinders with Fluoropolymer Resin Pestle

Description: Heavy, clear plastic coating on Potter-Elvehjem style tissue grinders protects mortar from scratches and provides surer grip. Coating containS glass and homogenate if breakage occurs. Transparent coating. Autoclavable. 10mL.
Catalog Number: 62400-325
Supplier: DWK Life Sciences (KIMBLE)

Certificates Small Business Enterprise


Product Image-62400-303

Safe-Grind* Plastic-Coated Tissue Grinders with Fluoropolymer Resin Pestle

Description: Heavy, clear plastic coating on Potter-Elvehjem style tissue grinders protects mortar from scratches and provides surer grip. Coating contains glass and homogenate if breakage occurs. Transparent coating. Autoclavable. 2mL.
Catalog Number: 62400-303
Supplier: DWK Life Sciences (KIMBLE)

Certificates Small Business Enterprise


Product Image-80074-168

STOPCOCK, STRAIGHT BORE, FLUOROPOLYMER RESIN

Description: PLUG ONLY FOR CG-424 FLUOROPOLYMER RESIN STOPCOCKS. Bore Size: 1; Plug Size: 11/25. Straight bore stopcock having a 1:5 taper solid fluoropolymer resin plug.
Catalog Number: 80074-168
Supplier: Chemglass

Small Business Enterprise


Product Image-80074-162

STOPCOCK, STRAIGHT BORE, FLUOROPOLYMER RESIN

Description: PLUG ONLY FOR CG-424 FLUOROPOLYMER RESIN STOPCOCKS. Bore Size: 3; Plug Size: 15.2/30. Straight bore stopcock having a 1:5 taper solid fluoropolymer resin plug.
Catalog Number: 80074-162
Supplier: Chemglass

Small Business Enterprise


Product Image-27589-120

47mm Filtration Assemblies, Components, Fritted Support Base, fluoropolymer resin-faced

Description: 47mm Filtration Assemblies With No. 8 Stopper Connection, With fluoropolymer resin Faced Support Base and Funnel. This unit is recommended when autoclaving with the filter in place.
Catalog Number: 27589-120
Supplier: DWK Life Sciences (KIMBLE)

Certificates Small Business Enterprise


Image Unavailable-H-5948.0001BA

CECROPIN A (1-7)-MELITTIN A (2-9)

Description: 1mg Cecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Throug h its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections. CAS: 157606-25-2 C89H152N22O15 FW: 1770.33 . Synonym: Cecropin A (1-8)-Melittin A (3-9) amide, CAMEL0, CM15
Catalog Number: H-5948.0001BA
Supplier: Bachem Americas
Image Unavailable-H-5948.0005BA

CECROPIN A (1-7)-MELITTIN A (2-9)

Description: 5mg Cecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Throug h its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections. CAS: 157606-25-2 C89H152N22O15 FW: 1770.33 . Synonym: Cecropin A (1-8)-Melittin A (3-9) amide, CAMEL0, CM15
Catalog Number: H-5948.0005BA
Supplier: Bachem Americas
Image Unavailable-CAAAAL19564-22

AMBERLITE R(RG XAD-7 100GM

Catalog Number: CAAAAL19564-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAAAL19564-36

AMBERLITE R(RG XAD-7 500GM

Catalog Number: CAAAAL19564-36
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-102996-264

PACAP (1-38) 1 mg

Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-264
Supplier: Anaspec Inc
Product Image-27589-122

47mm Filtration Assemblies, Components, Glass Funnel, fluoropolymer resin-faced, 300mL

Description: 47mm Filtration Assemblies With No. 8 Stopper Connection, With fluoropolymer resin Faced Support Base and Funnel. This unit is recommended when autoclaving with the filter in place.
Catalog Number: 27589-122
Supplier: DWK Life Sciences (KIMBLE)

Small Business Enterprise


Image Unavailable-102996-408

Glucagon-Like Peptide 1 1 mg

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-408
Supplier: Anaspec Inc
Product Image-27589-118

47mm Filtration Assemblies, with fluoropolymer resin-faced

Description: With fluoropolymer resin Faced Support Base and Funnel. This unit is recommended when autoclaving with the filter in place. The fluoropolymer resin coating prevents the filter from adhering to the ground glass surfaces.
Catalog Number: 27589-118
Supplier: DWK Life Sciences (KIMBLE)

Small Business Enterprise


Product Image-16200-456

Fluoropolymer resin PTFE Discs

Description: Neck size(mm-GPI Thread): 70.015" Solid Virgin fluoropolymer resin PTFE. Can be manually inserted into closures of appropriate size
Catalog Number: 16200-456
Supplier: Qorpak

Small Business Enterprise


1,217 - 1,232 of 13,527