Print…

You Searched For: New+fuchsine


3,981  results were found

Refine Results Sort by
SearchResultCount:"3981"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Product Image-89417-064

Anti-HA Rabbit Polyclonal Antibody

Catalog Number: (89417-064)
Supplier: Prosci
Description: Swine H1N1 Hemagglutinin Antibody: Influenza A virus is a major public health threat, killing more than 30, 000 people per year in the USA. In early 2009, a novel swine-origin influenza A (H1N1) virus was identified in specimens obtained from patients in Mexico and the United States. The virus spread quickly around the world and on June 11, 2009, the World Health Organization declared it a pandemic. Influenza A virus has one of sixteen possible Hemagglutinin (HA) surface proteins and one of nine possible Neuraminidase (NA) surface proteins. The Hemagglutinin protein facilitates viral attachment while Neuraminidase is involved in viral release. These proteins also elicit immune responses that prevent infection or independently reduce viral replication. The genetic make-up of this swine flu virus is unlike any other: it is an H1N1 strain that combines a triple assortment first identified in 1998 including human, swine, and avian influenza with two new pig H3N2 virus genes from Eurasia, themselves of recent human origin. The distinct antigenic properties of the new swine influenza virus compared with seasonal influenza A (H1N1) virus suggest that human immunity against new swine influenza virus is limited, although the age distribution of reported cases suggests some degree of protection in older age groups.
Product Image-10746-444

Vileda® Professional Sterile Roll-O-Matic® Sponge Refills, Vileda Professional-FHP

Supplier: Vileda Professional - FHP
Description: The new "Advanced Technology" foam is manufactured specifically for the controlled environment industry. This foam allows 25% more liquid absorption and two times more liquid release than competing foams. Each refill is completely autoclavable and resistant to gamma and ETO sterilization. Refills are individually packaged and lot number controlled. All Vileda® Professional brand refills are ideal for use with the "Pull and Lift" technique most commonly used in controlled environments. Manufactured in the USA.

Product Image-10075-376

Anti-GRIN1 Rabbit Polyclonal Antibody

Catalog Number: (10075-376)
Supplier: Prosci
Description: The ion channels activated by glutamate are typically divided into two classes. Those that are sensitive to N-methyl-D-aspartate (NMDA) are designated NMDA receptors (NMDAR). The NMDAR plays an essential role in memory, neuronal development and it has also been implicated in several disorders of the central nervous system including Alzheimer’s disease, epilepsy and ischemic neuronal cell death. Increased membrane surface expression of the NR1 subunit of the receptor has been associated with synaptic plasticity. There are a number of different splice variants of the NR1. Differential splicing of three exons in the NR1 subunit generates up to eight NR1 splice variants and 7 of these have been identified in cDNA libraries. These exons encode a 21 amino acid N-terminal domain (N1) and adjacent sequences in the C-terminus (C1 and C2). Splicing out the C2 cassette eliminates the first stop codon and produces a new reading frame that generates a new sequence of 22 amino acids (C2'). Considerable attention has been focused on the distribution and expression of these splice variants that may affect the functional properties and regulation of the NMDAR.
Product Image-10075-378

Anti-GRIN1 Rabbit Polyclonal Antibody

Catalog Number: (10075-378)
Supplier: Prosci
Description: The ion channels activated by glutamate are typically divided into two classes. Those that are sensitive to N-methyl-D-aspartate (NMDA) are designated NMDA receptors (NMDAR). The NMDAR plays an essential role in memory, neuronal development and it has also been implicated in several disorders of the central nervous system including Alzheimer’s disease, epilepsy and ischemic neuronal cell death. Increased membrane surface expression of the NR1 subunit of the receptor has been associated with synaptic plasticity. There are a number of different splice variants of the NR1. Differential splicing of three exons in the NR1 subunit generates up to eight NR1 splice variants and 7 of these have been identified in cDNA libraries. These exons encode a 21 amino acid N-terminal domain (N1) and adjacent sequences in the C-terminus (C1 and C2). Splicing out the C2 cassette eliminates the first stop codon and produces a new reading frame that generates a new sequence of 22 amino acids (C2'). Considerable attention has been focused on the distribution and expression of these splice variants that may affect the functional properties and regulation of the NMDAR.
Image Unavailable-10396-520

Anti-SLC25A20 Rabbit Polyclonal Antibody

Catalog Number: (10396-520)
Supplier: Bioss
Description: SLC25A20 is one of several closely related mitochondrial membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. It mediates the transport of acylcarnitines into the mitochondrial matrix for their oxidation by the mitochondrial fatty acid oxidation pathway. Mutations in this gene are associated with carnitine acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.
Image Unavailable-10082-844

Anti-AMOT Mouse Monoclonal Antibody [clone: 3H7B3]

Catalog Number: (10082-844)
Supplier: Proteintech
Description: predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Most abundant expression was found in placenta and skeletal muscle. AMOT has two isoforms with MW 130 kDa (p130) and 80 kDa (p80). This antibody recognizes p130 only.
Product Image-100492-766

Illuminated Magnilites® Vision-Lite® 2000, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: The Vision-Lite® 2000 is the world’s first dimmable fluorescent illuminated magnifier. New "patented" state-of-the-art microchip controlled ballast technology allows the Vision-Lite® 2000 to be dimmable from 100% down to 25% so that highly reflective surfaces can easily be seen by dimming the units exclusive "Glare-Free" bulb. An exclusive slide switch allows the operator to change illumination intensity with the stroke of a finger.

Minority or Woman-Owned Business Enterprise

Image Unavailable-89359-176

Anti-GFP Mouse Monoclonal Antibody

Catalog Number: (89359-176)
Supplier: Genetex
Description: The jellyfish Aequorea victoria contains green fluorescent protein (GFP) that emits light in the bioluminescence reaction of the animal. GFP has been used widely as a reporter protein for gene expression in eukaryotic and prokaryotic organisms, and as a protein tag in cell culture and in multicellular organisms. As a fusion tag, GFP can be used to localize proteins, to study their movement or to research the dynamics of the subcellular compartments where these proteins are targeted. GFP technology has revealed considerable new insights into the physiological activities of living cells.
Image Unavailable-103007-276

Influenza Matrix Protein (62-70)

Catalog Number: (103007-276)
Supplier: Anaspec
Description: This peptide is a fragment of the influenza virus matrix protein amino acid residues 62 to 70. It contains the core sequence of a new major histocompatibility complex class II-restricted T-cell epitope of influenza virus matrix protein. This epitope was detected in the peripheral blood of influenza A patients.
Sequence:GFVFTLTVPSER
MW:1352.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-89357-654

Anti-GFP Rabbit Polyclonal Antibody

Catalog Number: (89357-654)
Supplier: Genetex
Description: The jellyfish Aequorea victoria contains green fluorescent protein (GFP) that emits light in the bioluminescence reaction of the animal. GFP has been used widely as a reporter protein for gene expression in eukaryotic and prokaryotic organisms, and as a protein tag in cell culture and in multicellular organisms. As a fusion tag, GFP can be used to localize proteins, to study their movement or to research the dynamics of the subcellular compartments where these proteins are targeted. GFP technology has revealed considerable new insights into the physiological activities of living cells.
Image Unavailable-10401-772

Anti-SLC25A20 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10401-772)
Supplier: Bioss
Description: SLC25A20 is one of several closely related mitochondrial membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. It mediates the transport of acylcarnitines into the mitochondrial matrix for their oxidation by the mitochondrial fatty acid oxidation pathway. Mutations in this gene are associated with carnitine acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.
Image Unavailable-76077-956

Anti-SLC25A20 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76077-956)
Supplier: Bioss
Description: SLC25A20 is one of several closely related mitochondrial membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. It mediates the transport of acylcarnitines into the mitochondrial matrix for their oxidation by the mitochondrial fatty acid oxidation pathway. Mutations in this gene are associated with carnitine acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.
Product Image-89417-016

Anti-PTER Rabbit Polyclonal Antibody

Catalog Number: (89417-016)
Supplier: Prosci
Description: PTER Antibody: PTER is a mammalian homolog to bacterial phosphotriesterases, enzymes that hydrolyze phosphotriester-containing organophosphate pesticides. It is expressed primarily in the proximal renal tubules and the gene has been localized in humans to chromosomal band 10p12 by in situ hybridization. PTER, in addition to FTO, MC4R, and NPC1 has recently been shown to be a new risk loci for early-onset and morbid adult obesity in European populations. At least two isoforms of PTER are known to exist.
Image Unavailable-B-4300.0005BA

Fmoc-Phe-Thr(Psi(Me,Me)Pro)-Oh

Catalog Number: (B-4300.0005BA)
Supplier: Bachem Americas
Description: These dipeptide building blocks containing Ser- or Thr-derived oxazolidines (pseudoprolines) proved to be versatile tools for overcoming some intrinsic problems in the field of peptide chemistry. The presence of pseudoprolines within a peptide sequence results in the disruption of β-sheet structures considered as a source of intermolecular aggregation during chain elongation, thus increasing solvation and coupling kinetics in peptide assembly. Therefore, use of pseudoprolines offer new possibilities for accessing large peptides by convergent strategies and chemoselective ligation techniques. Moreover, incorporation of a pseudoproline unit facilitates cyclization of peptides.
Image Unavailable-B-4285.0005BA

Fmoc-Glu(Otbu)-Ser(Psi(Me,Me)Pro)-Oh

Catalog Number: (B-4285.0005BA)
Supplier: Bachem Americas
Description: These dipeptide building blocks containing Ser- or Thr-derived oxazolidines (pseudoprolines) proved to be versatile tools for overcoming some intrinsic problems in the field of peptide chemistry. The presence of pseudoprolines within a peptide sequence results in the disruption of β-sheet structures considered as a source of intermolecular aggregation during chain elongation, thus increasing solvation and coupling kinetics in peptide assembly. Therefore, use of pseudoprolines offer new possibilities for accessing large peptides by convergent strategies and chemoselective ligation techniques. Moreover, incorporation of a pseudoproline unit facilitates cyclization of peptides.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,665 - 1,680 of 3,981
no targeter for Bottom