Print…

You Searched For: Nepsilon-acetyl-L-lysine


5,749  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"5749"

Rate These Search Results

Image Unavailable-103009-918

[Lys(Me2)27, Lys(Me1)36]-Histone H3 (21-44)-GK,Biotin

Description: [Lys(Me2)27, Lys(Me1)36]-Histone H3 (21-44)-GK,Biotin
Catalog Number: 103009-918
Supplier: Anaspec Inc
Product Image-10088-216

Anti-KDM2A

Description: Anti-KDM2A Antibody, Host Species: Rabbit, Cross Reactivity: Human, Immunogen: Fusion Protein, 374-558 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10088-216
Supplier: Proteintech
Image Unavailable-E-1135.0005BA

Ac-Met-OH

Catalog Number: E-1135.0005BA
Supplier: Bachem Americas
Image Unavailable-E-1135.0025BA

Ac-Met-OH

Catalog Number: E-1135.0025BA
Supplier: Bachem Americas
Image Unavailable-TCA1014-5ML

2-Acetyl-1-methylpyrrole, Min 98.0% (GC)

Description: 5ML MDL Number: 00003089, Beilstein: 21(000)00,0272, Mol. Formula: C7H9NO, Mol. Wt.: 123.16, PubChem SID: 87562507, CAS: 932-16-1, 932-16-1, C7H9NO, 123.16
Catalog Number: TCA1014-5ML
Supplier: TCI America

SDS


Image Unavailable-CAPIPA5-18853

MARCH10 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Rat (Rt) Immunogen:Synthetic peptide sequence (SRNYPQPRTEE) corresponding to the internal amino acids of 40238
Catalog Number: CAPIPA5-18853
Supplier: Thermo Scientific
Image Unavailable-E-1025.0025BA

Ac-Arg-OH

Catalog Number: E-1025.0025BA
Supplier: Bachem Americas
Image Unavailable-E-1025.0100BA

Ac-Arg-OH

Catalog Number: E-1025.0100BA
Supplier: Bachem Americas
Image Unavailable-TCA2160-5G

N-Acetyl-D-Mannosamine Monohydrate

Description: , 3615-17-6, C8H15NO6, 221.21
Catalog Number: TCA2160-5G
Supplier: TCI America

SDS


Image Unavailable-TCA2160-1G

N-Acetyl-D-Mannosamine Monohydrate

Description: , 3615-17-6, C8H15NO6, 221.21
Catalog Number: TCA2160-1G
Supplier: TCI America

SDS


Image Unavailable-102996-408

Glucagon-Like Peptide 1 1 mg

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-408
Supplier: Anaspec Inc
Image Unavailable-TCA1316-010G

, 40020-87-9, C10H8O3, 176.17

Description: , 40020-87-9, C10H8O3, 176.17
Catalog Number: TCA1316-010G
Supplier: TCI America

SDS


Image Unavailable-103008-150

Erythropoietin-Mimetic Peptide 17 (EMP17)

Description: Erythropoietin-Mimetic Peptide 17 (EMP17)
Catalog Number: 103008-150
Supplier: Anaspec Inc
Image Unavailable-103007-982

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me3) 1 mg

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 1 mg
Catalog Number: 103007-982
Supplier: Anaspec Inc
Product Image-82051-356

CELLCOAT 384 Well Plate

Description: Polystyrene, Coated with Poly-D-Lysine, White, with Lid.
Catalog Number: 82051-356
Supplier: Greiner Bio-One
Product Image-82051-352

CELLCOAT 384 Well Plate

Description: Polystyrene, Coated with Poly-D-Lysine, Clear, with Lid.
Catalog Number: 82051-352
Supplier: Greiner Bio-One
1,089 - 1,104 of 5,749