Print…

You Searched For: N-Ethylmaleimide


43  results were found

Refine Results Sort by
SearchResultCount:"43"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAPI23030

N-Ethylmaleimide (NEM), Pierce™

Catalog Number: (CAPI23030)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce N-Ethylmaleimide (NEM) is a small compound that forms stable, covalent thioether bonds with sulfhydryls (e.g., reduced cysteines), enabling them to be permanently blocked to prevent disulfide bond formation.

SDS Certificates


Image Unavailable-CA80055-246

N-Ethylmaleimide (NEM), Calbiochem®

Catalog Number: (CA80055-246)
Supplier: MilliporeSigma
Description: Sulfhydryl alkylating reagent

Certificates


Image Unavailable-CAAAAL00355-18

N-Ethylmaleimide (NEM) 98+%

Supplier: Thermo Scientific Chemicals
Description: Cysteine alkylating agent

Certificates

Image Unavailable-CAAA40526-03

N-Ethylmaleimide (NEM) 99+%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00005509 Beilstein Registry No.: 112448

Certificates

Product Image-76857-046

Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Polyclonal Antibody

Catalog Number: (76857-046)
Supplier: ANTIBODIES.COM LLC
Description: Rabbit polyclonal antibody to N-ethylmaleimide-sensitive fusion protein for WB, ICC/IF and IP with samples derived from Human, Mouse, Rat and Zebrafish.
Image Unavailable-89320-402

Anti-PIGX Rabbit Polyclonal Antibody

Catalog Number: (89320-402)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to NSF (N-ethylmaleimide-sensitive factor)
Product Image-77211-964

Human N-ethylmaleimide-sensitive Fusion Protein ELISA Kit

Catalog Number: (77211-964)
Supplier: ANTIBODIES.COM LLC
Description: Human N-ethylmaleimide-sensitive Fusion Protein ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human N-ethylmaleimide-sensitive Fusion Protein in serum, plasma, and other biological fluids.
Image Unavailable-89359-352

Anti-NSF Mouse Monoclonal Antibody [clone: 9G7-3]

Catalog Number: (89359-352)
Supplier: Genetex
Description: N ethylmaleimide sensitive factor (NSF) is an ~83 kDa protein (predicted MW) which was initially isolated based on its ability to restore intercisternal Golgi transport to N ethylmaleimide treated membranes. NSF was subsequently discovered to be involved in a variety of membrane fusion events. NSF is an ATPase with two ATP binding domains that are essential for membrane fusion and homo oligomerization. In order to interact with target membranes, NSF requires another set of soluble proteins called Soluble NSF attachment proteins (SNAPs). NSF has been shown to play a prominent role in synaptic vesicle fusion. Together with synaptotagmin and a SNAP, NSF modulates the interaction of SNAP25, VAMP, and syntaxin, in an ATP dependent manner, to form a complex with a sedimentation coefficient of 20 S. This complex may represent an intermediate involved in synaptic vesicle docking and fusion.
Product Image-89356-252

Anti-NSF Rabbit Polyclonal Antibody

Catalog Number: (89356-252)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to NSF (N-ethylmaleimide-sensitive factor)
Product Image-77518-694

Human NSF (N-Ethylmaleimide Sensitive Factor) ELISA Kit

Catalog Number: (77518-694)
Supplier: AFG Bioscience
Description: Human NSF (N-Ethylmaleimide Sensitive Factor) ELISA Kit
Image Unavailable-ABCA_AB302789-100U

Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Monoclonal Antibody [clone: EPR25190-1]

Supplier: Abcam
Description: Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Monoclonal Antibody [clone: EPR25190-1]

New Product

Product Image-CA95046-454

Anti-N-Ethylmaleimide-Sensitive Fusion Protein Mouse Monoclonal Antibody

Catalog Number: (CA95046-454)
Supplier: Enzo Life Sciences
Description: N-ethylmaleimide-sensitive factor (NSF) is involved in a variety of membrane fusion events and plays a prominent role in synaptic vesicle fusion. In order to interact with target membranes, NSF requires another set of soluble proteins called Soluble NSF attachment proteins (SNAPs). Together with synaptotagmin and alpha-SNAP, NSF modulates the interaction of SNAP25, VAMP, and syntaxin in an ATP-dependent manner to form a 20S complex involved in synaptic vesicle docking and fusion.
Image Unavailable-ABCA_AB126202-50UL

Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Polyclonal Antibody

Catalog Number: (ABCA_AB126202-50UL)
Supplier: Abcam
Description: Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Polyclonal Antibody

New Product


Image Unavailable-ABCA_AB302788-20UL

Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Monoclonal Antibody [clone: EPR25190-1]

Supplier: Abcam
Description: Anti-N-ethylmaleimide-sensitive fusion protein Rabbit Monoclonal Antibody [clone: EPR25190-1]

New Product

Product Image-89354-744

Anti-NAPA Rabbit Polyclonal Antibody

Catalog Number: (89354-744)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to alpha SNAP (N-ethylmaleimide-sensitive factor attachment protein, alpha)
Image Unavailable-103007-244

HIV TAT-NSF700scr Peptide

Catalog Number: (103007-244)
Supplier: Anaspec Inc
Description: This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.
Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
MW: 4109.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1 - 16 of 43
no targeter for Bottom