You Searched For: N-Boc-L-aspartic+acid+4-cyclohexyl+ester


68,543  results were found

SearchResultCount:"68543"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76083-068)
Supplier: Bioss
Description: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.


Catalog Number: (CAMB-114-0001)
Supplier: Rockland Immunochemical
Description: All enzymes and related reagents are configured as an integrated system and have been thoroughly tested.

SDS


Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (CA80058-432)
Supplier: MilliporeSigma
Description: MOPS-Na, ULTROL®

Catalog Number: (10075-662)
Supplier: Prosci
Description: The ion channels activated by glutamate are typically divided into two classes. Those that are sensitive to N-methyl-D-aspartate (NMDA) are designated NMDA receptors (NMDAR) while those activated by alpha-amino-3-hydroxy-5-methyl-4-isoxalone propionic acid (AMPA) are known as AMPA receptors (AMPAR). The AMPAR are comprised of 4 distinct subunits (GluR1-4) and they play key roles in virtually all excitatory neurotransmission in the brain. The GluR1 subunit is widely expressed throughout the nervous system. GluR1 is also potentiated by phosphorylation at Ser845. In addition, phosphorylation of this site has been linked to synaptic plasticity as well and learning and memory.


Catalog Number: (76234-810)
Supplier: Rockland Immunochemical
Description: Tumor necrosis factor receptor superfamily member 1A (TNF p55 Receptor) is a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. It contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.


Supplier: Thermo Scientific Chemicals
Description: MOPS-Na 98%
Catalog Number: (10749-370)
Supplier: Prosci
Description: BACE Antibody: Accumulation of the amyloid-beta (Abeta) plaque in the cerebral cortex is a critical event in the pathogenesis of Alzheimer's disease. Abeta peptide is generated by proteolytic cleavage of the beta-amyloid protein precursor (APP) at beta- and gamma-sites by two proteases. APP is first cleaved by beta-secretase, producing a soluble derivative of the protein and a membrane anchored 99-amino acid carboxy-terminal fragment (C99). The C99 fragment serves as substrate for gamma-secretase to generate the 4 kDa amyloid-beta peptide, which is deposited in the brains of all suffers of Alzheimer's disease. The long-sought beta-secretase was recently identified by several groups independently and designated beta-site APP cleaving enzyme (BACE) and aspartyl protease 2 (Asp2). BACE/Asp2 is a novel transmembrane aspartic protease and colocalizes with APP.


Catalog Number: (10749-368)
Supplier: Prosci
Description: BACE2 Antibody: Accumulation of the amyloid-beta (Abeta) plaque in the cerebral cortex is a critical event in the pathogenesis of Alzheimer's disease. Abeta peptide is generated by proteolytic cleavage of the beta-amyloid protein precursor (APP) at beta- and gamma-sites by proteases. The long-sought beta-secretase was recently identified by several groups independently and designated beta-site APP cleaving enzyme (BACE) and aspartyl protease 2 (Asp2). BACE/Asp2 is a novel transmembrane aspartic protease and co-localizes with APP. A BACE homolog was recently cloned and designated BACE2, Asp1, DRAP (for Down region aspartic protease), and memapsin 1. BACE2 also cleaves APP at b-site and at a different site within Abeta. BACE2 locates on chromosome 21q22.3, the so-called ‘Down critical region', suggesting that BACE2 and Abeta may also contribute to the pathogenesis of Down syndrome.


Catalog Number: (10750-584)
Supplier: Prosci
Description: HAAO Antibody: HAAO (3-Hydroxyanthranilate 3, 4-dioxygenase) is a monomeric cytosolic protein of the family of intramolecular dioxygenases containing non-heme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is present in low amounts in the central nervous system. This enzyme participates in tryptophan metabolism. It employs one cofactor, iron. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurological and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. Furthermore, recent study shows that HAAO are excellent candidate biomarkers for detecting ovarian cancer.


Catalog Number: (10075-660)
Supplier: Prosci
Description: The ion channels activated by glutamate are typically divided into two classes. Those that are sensitive to N-methyl-D-aspartate (NMDA) are designated NMDA receptors (NMDAR) while those activated by beta-amino-3-hydroxy-5-methyl-4-isoxalone propionic acid (AMPA) are known as AMPA receptors (AMPAR). The AMPAR are comprised of four distinct subunits GluR1-4 and they play key roles in virtually all excitatory neurotransmission in the brain. The GluR1 subunit is widely expressed throughout the nervous system. GluR1 is also potentiated by phosphorylation at Ser831. In addition, phosphorylation of this site has been linked to synaptic plasticity as well and learning and memory.


Catalog Number: (TCG0121-001G)
Supplier: TCI America
Description: CAS Number: 4685-12-5
MDL Number: MFCD00025585
Molecular Formula: C6H10N2O5
Molecular Weight: 190.16
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: 13 deg (C=2, H2O)

SDS


Supplier: TCI America
Description: CAS Number: 4432-31-9
MDL Number: MFCD00006181
Molecular Formula: C6H13NO4S
Molecular Weight: 195.23
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 316
Catalog Number: (10078-840)
Supplier: Prosci
Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.


Supplier: MilliporeSigma
Description: A zwitterionic buffer useful in the pH range of 5.5 to 6.5, has a pKa of 6.10 at 25 °C.
Catalog Number: (10084-084)
Supplier: Proteintech
Description: Caspase 12 is an enzyme known as a cysteine protease. It belongs to a family of enzymes called caspases that cleave their substrates at C-terminal aspartic acid residues. It is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. Caspase-12 is located in the endoplasmic reticulum (ER). It is responsible for ER-stress-induced apoptosis, such as high calcium concentration, low oxygen and low glucose levels. Caspase-12 Antibody detects endogenous levels of full-length caspase-12 protein (50 kDa) and its cleaved product (40-44 kDa). This antibody does not cross-react with other caspases.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
401 - 416 of 68,543
no targeter for Bottom