You Searched For: Maleimide

Catalog Number: (CAPI22362)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce LC-SMCC is an amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a long cyclohexane-stabilized spacer arm (16.2 angstroms).

Certificates

Catalog Number: (CAPI22324)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-GMBS is a water-soluble amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a short spacer arm (7.3 angstroms).

SDS Certificates

Catalog Number: (CAPI22298)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce BMPS is an amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a short spacer arm (5.9 Å).

Certificates

Catalog Number: (CAPI22307)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-EMCS is a water-soluble amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a medium-length spacer arm (9.4 angstroms).

Certificates

Catalog Number: (CAPI21111)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-KMUS is a water-soluble amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a long spacer arm (16.3 angstroms).

Certificates

Catalog Number: (CAPI22360)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce SMCC is a hetero-bifunctional crosslinker that contain N-hydroxysuccinimide (NHS) ester and maleimide groups that allow covalent conjugation of amine- and sulfhydryl-containing molecules. NHS esters react with primary amines at pH 7–9 to form amide bonds, while maleimides react with sulfhydryl groups at pH 6.5–7.5 to form stable thioether bonds. In aqueous solutions, NHS ester hydrolytic degradation is a competing reaction whose rate increases with pH. The maleimide group is more stable than the NHS-ester group, but will slowly hydrolyze and lose its reaction specificity for sulfhydryls at pH values > 7.5. For these reasons, conjugations with these crosslinkers are usually performed at pH 7.2–7.5, with the NHS ester (amine-targeted) reacted before or simultaneous with the maleimide (sulfhydryl-targeted) reaction.

SDS Certificates

Catalog Number: (CAPI22330)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce BMH is a long-arm, maleimide crosslinker for covalent, irreversible conjugation between sulfhydryl groups (e.g., protein or peptide cysteines).

SDS Certificates

Catalog Number: (CAPI22312)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-MBS is a water-soluble amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a short aromatic spacer arm (7.3 angstroms).

Certificates

Catalog Number: (CAPI22335)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce DTME is a mid-length, maleimide crosslinker for reversible covalent conjugation between sulfhydryl groups (e.g., protein or peptide cysteines) by reduction of the disulfide bond in the center of the spacer arm.

Certificates

Catalog Number: (CAPI22308)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce EMCS is an amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a medium-length spacer arm (9.4 angstroms).

Certificates

Catalog Number: (CAPI22106)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce EMCH is a mid-length, maleimide-and-hydrazide crosslinker for conjugating sulfhydryls (cysteines) to carbonyls (aldehyde or ketones, such as those formed by oxidation of glycoprotein carbohydrates).

Certificates

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-SMCC, No-Weigh Format is a water-soluble, amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a medium-length cyclohexane spacer arm (8.3 angstroms).

Certificates

Catalog Number: (CAPI22317)

Supplier: Thermo Scientific

Description: Thermo Scientific Pierce Sulfo-SMPB is a water-soluble amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a medium-length aromatic spacer arm (11.6 angstroms).

SDS

Supplier: Anaspec Inc

Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-440)

Supplier: Anaspec Inc

Description: B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. SMCC activated B-PE is chemically modified with SMCC. SMCC reacts with the primary amine on B-PE and introduces maleimide groups to B-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of B-PE with proteins. Its primary absorption peak is at 545 nm with secondary peak at 563 nm. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE conjugates have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Catalog Number: (103007-246)

Supplier: Anaspec Inc

Description: This is a scrambled TAT-NSF222scr fusion polypeptide. It is composed of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide, 3 glycines as a linker, followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. This peptide is used as a control for the TAT-NSF222 peptide.
Sequence: YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
MW: 4214.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C