You Searched For: Heat+Stress+Meters


10,381  results were found

SearchResultCount:"10381"

Sort Results

List View Easy View

Rate These Search Results

Supplier: LaMotte
Description: Measure oxygen concentration and percent saturation

Catalog Number: (76333-628)
Supplier: Chemglass
Description: Digital display meters/monitors for use with CG-1872 pH electrodes with an integrated PT100 sensor for temperature correction.


Supplier: Mettler Toledo

Catalog Number: (470202-642)
Supplier: NEW GENIE GROUP INC SE
Description: Flat electrode surface allows pH readings in liquid flms, semi-solids, and solids.


Supplier: Anaspec Inc
Description: Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (76214-014)
Supplier: Sper Scientific
Description: Measures dissolved oxygen to determine water quality in environmental testing, labs, industrial and municipal waste water, aquariums and fish hatcheries.


Catalog Number: (10750-616)
Supplier: Prosci
Description: FAM120A Antibody: FAM120A (C9orf10) is a member of the constitutive coactivator of PPAR gamma family and the gene was mapped to chromosome 9q22.31. FAM120A was recently detected within the Pur-alpha-containing mRNA-protein complex in the brain. As a novel RNA-binding protein, FAM120A is a critical component of the oxidative stress-induced survival signaling. It may participate in mRNA transport in the cytoplasm. FAM120A activates src family kinases and acts as a scaffolding protein enabling src family kinases to phosphorylate and activate PI3-kinase. FAM120A protects cells from apoptosis through activation of SRKs in response to oxidative stress. Blocking of the survival signaling mediated by FAM120A, which sensitizes the cancer cells to stress-induced apoptosis, may be a novel therapeutic approach for gastric scirrhous carcinoma cells.


Catalog Number: (10749-560)
Supplier: Prosci
Description: Caspase-12 Antibody: (Large)Three distinct signaling pathways lead to programmed cell death (apoptosis). The death receptor and mitochondrion pathways are the main, in which the key apoptotic proteases capase-8 and caspase-9, respectively, are involved. The endoplasmic reticulum (ER) stress is the third apoptotic pathway and caspase-12 is involved. Caspase-12 is localized to the ER but not to cytoplasm or mitochondrion. Caspase-12 is activated by ER stress, including disruption of ER calcium homeostasis, and mediates ER stress-induced apoptosis. Caspase-12 is co-localized to the ER with several proteins that are involved in Alzheimer's disease including gamma-secretase presenilin and beta-amyloid precursor protein (APP). Caspase-12 mediates cytotoxicity induced by amyloid-beta. Caspase-12 is ubiquitously expressed in mouse tissues.


Supplier: LaMotte
Description: Store Up to 15 Readings

Catalog Number: (CAPIPA5-12383)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with bovine based on sequence homology. GADD45A responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45A gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms.


Catalog Number: (76258-438)
Supplier: Antyila Scientific
Description: Designed to be durable and easy to use.


Catalog Number: (10065-236)
Supplier: YSI
Description: The Pro2030 provides everything you need in a handheld dissolved oxygen meter that automatically compensates for changes in salinity values.


Catalog Number: (MSPP-81128)
Supplier: IBIDI USA MS
Description: A bottomless channel slide used for perfusion applications with a self-adhesive underside designed for perfusion applications and applying defined shear stress and shear rates on cells inside the channel.


Catalog Number: (CA11278-286)
Supplier: Mettler Toledo
Description: Accessories for Seven2Go® Portable Meters, Mettler Toledo


Supplier: TMW Media Group
Description: How to help with depression.

Supplier: Mettler Toledo
Description: Triple channel SevenExcellence pH/mV/DO and conductivity meter.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
753 - 768 of 10,381
no targeter for Bottom