You Searched For: Heat+Stress+Meters


9,734  results were found

SearchResultCount:"9734"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10068-552)
Supplier: Prosci
Description: Involved in stress resistance and actin organization.


Catalog Number: (10393-560)
Supplier: Bioss
Description: May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. May play a role in hematopoietic lineage decisions and growth regulation.


Catalog Number: (89206-418)
Supplier: Thermo Fisher Scientific
Description: Add dissolved oxygen and temperature measurement capabilities to Versa Star™ meter using the Orion™ Versa Star™ Dissolved Oxygen/RDO Measurement Module.


Catalog Number: (10349-710)
Supplier: Bioss
Description: MSK1 is a mitogen and stress activated protein kinase 1 which belongs to the AGC family of kinases and is related in structure to the ribosomal p70 S6 kinase subfamily. MSK1 can be activated by ERK1/2 and SAPK2/p38 MAP kinase. It is also known to be required for the phosphorylation of CREB, ATF1 H3 and HMG14 in response to mitogen and stress. Similar to RSK, MSK1 contains two kinase domains (N term and a C term). Once phosphorylated on Thr581 and Ser360 by ERK1/2 and SAPK2/p38, MSK1 autophosphorylate on at least 5 sites. Of these autophosphorylation sites Ser212 and Ser376 get phosphorylated by the C terminal kinase domain of MSK1 which is essential for the catalytic activity of the N terminal kinase domain. MSK2 plays an essential role in the control of RELA transcriptional activity in response to TNF. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14). In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines. Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors.


Catalog Number: (76083-206)
Supplier: Bioss
Description: MSK1 is a mitogen and stress activated protein kinase 1 which belongs to the AGC family of kinases and is related in structure to the ribosomal p70 S6 kinase subfamily. MSK1 can be activated by ERK1/2 and SAPK2/p38 MAP kinase. It is also known to be required for the phosphorylation of CREB, ATF1 H3 and HMG14 in response to mitogen and stress. Similar to RSK, MSK1 contains two kinase domains (N term and a C term). Once phosphorylated on Thr581 and Ser360 by ERK1/2 and SAPK2/p38, MSK1 autophosphorylate on at least 5 sites. Of these autophosphorylation sites Ser212 and Ser376 get phosphorylated by the C terminal kinase domain of MSK1 which is essential for the catalytic activity of the N terminal kinase domain. MSK2 plays an essential role in the control of RELA transcriptional activity in response to TNF. Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN. May also phosphorylate 'Ser-28' of histone H3. Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14). In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines. Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors.


Supplier: Ohaus
Description: Highly reliable and user-friendly pH benchtop meter for standard laboratory applications.

Catalog Number: (89415-780)
Supplier: Prosci
Description: Caspase-2 Antibody: Caspases are a family of cysteine proteases that can be divided into the apoptotic and inflammatory caspase subfamilies. Unlike the apoptotic caspases, members of the inflammatory subfamily are generally not involved in cell death but are associated with the immune response to microbial pathogens. Members of this subfamily include caspase-1, -4, -5, and -12 and can activate proinflammatory cytokines such as IL-1 beta and IL-18. Although phylogenetically similar to this subfamily, Caspase-2 is thought to be involved in stress-induced apoptosis. Caspase-2 has two major isoforms; overexpression on the long form results in apoptosis while that of the short form suppresses cell death.


Supplier: IN-SITU, INC.
Description: The smarTROLL Rugged Dissolved Oxygen (RDO) Handheld combines optical dissolved oxygen (DO) technology with revolutionary smartphone mobility

Catalog Number: (CA470349-824)
Supplier: Hanna
Description: This multiparameter meter is a waterproof portable logging multiparameter meter. The microprocessor based multi-sensor probe allows for the measurement of key parameters including pH, ORP, conductivity, dissolved oxygen, turbidity, and temperature. The complete system is simple to setup and easy to use.


Catalog Number: (89165-918)
Supplier: Enzo Life Sciences
Description: This kit has been designed for monitoring protein stability under systematic thermal stress conditions.


Catalog Number: (10068-606)
Supplier: Prosci
Description: Involved in stress resistance and actin organization.


Supplier: Anaspec Inc
Description: Neuropeptide Y (NPY) is a 36aa neuropeptide involved in food intake, fat metabolism, stress and pain reduction, and vasodilation
Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW:4271.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (MFLX77915-10)
Supplier: Avantor Fluid Handling
Description: Ideal for chemical feed/metering and applications requiring high-purity, high-pressure or both.

ISO9001 CE Compliant


Catalog Number: (97057-042)
Supplier: Sper Scientific
Description: This tiny laser power meter is less than ¾” thick, weighing only 4 oz


Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Description: Battery-powered and portable flow meter for measuring gas streams with changing composition.

Supplier: Antyila Scientific
Description: Developed using extensive feedback from laboratory staff, our new Environmental Express 2000 series meters are assembled in various configurations for measuring a pH/mV, EC, Ion, DO, BOD parameters.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
737 - 752 of 9,734
no targeter for Bottom