Print…

You Searched For: Fmoc-\u03B1-Me-D-Leu-OH


9,421  results were found

Refine Results Sort by
SearchResultCount:"9421"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-H-6226.0250BA

LPP

Catalog Number: (H-6226.0250BA)
Supplier: Bachem Americas
Description: These short peptides act as angiotensin I-converting enzyme (ACE) inhibitors. See also Phe-Tyr (G-2955) and the subfamilies 'Bradykinin-Potentiating Peptide (BPP)' and 'Angiotensin I-Converting Enzyme (ACE, ACE2) Inhibitors'.
Image Unavailable-102996-268

Syntide-2

Catalog Number: (102996-268)
Supplier: Anaspec Inc
Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-244

SensoLyte® 520 MMP-12 Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-244)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components
Image Unavailable-TCB4184-5G

Nδ-(tert-Butoxycarbonyl)-Nɑ-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-ornithine ≥98.0% (by HPLC, titration analysis)

Catalog Number: (TCB4184-5G)
Supplier: TCI America
Description: CAS Number: 109425-55-0
MDL Number: MFCD00065668
Molecular Formula: C25H30N2O6
Molecular Weight: 454.52
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 134
Specific rotation [a]20/D: -9 deg (C=1, DMF)
Storage Temperature: 0-10°C

SDS


Image Unavailable-N-1765.0025BA

(4-((2-Methylphenyl)aminocarbonyl)-aminophenyl)acetyl-Fibronectin CS-1 Fragment (1980-1983), Bachem

Supplier: Bachem Americas
Description: The VLA-4 inhibitor BIO-1211 based on the LDVP motif represents a selective, tight-binding inhibitor of integrin α₄β₁ achieved by appending an optimal organic group to the N-terminus of the peptide (Kd = 70 pM). Moreover, this inhibitor exhibited > 200-fold selectivity for the activated form of the integrin α₄β₁ receptor.

Image Unavailable-102996-548

[Leu5]-Enkephalin

Catalog Number: (102996-548)
Supplier: Anaspec Inc
Description: Enkephalins are pentapeptides involved in regulating nociception in the body. There are two enkephalin forms, one containing leucine and the other containing methionine ("met"). Both are products of the proenkephalin gene.
Sequence:YGGFL
MW:555.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-N-1015.0025BA

Proctolin

Catalog Number: (N-1015.0025BA)
Supplier: Bachem Americas
Description: Proctolin, RYLPT, the first insect neuropeptide, was isolated from the cockroach Periplaneta americana. This peptide is synthesized in the central nervous system of several insect species and arthropods and it was originally considered as a visceral muscle neurotransmitter. It later became apparent that proctolin also acts as a neuromodulator affecting myogenic muscle activity or neurally evoked contractions on visceral and skeletal muscles.
Image Unavailable-103010-104

Rat GIP

Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-102996-526

Dynorphin A (1-17)

Supplier: Anaspec Inc
Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRIRPKLKWDNQ
MW:2147.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-D-1965.0005BA

2-Chlorotrityl chloride, polymer supported 200-400 mesh

Supplier: Bachem Americas
Description: A very acid sensitive resin suitable for the synthesis of protected peptide fragments by the Fmoc-strategy. ClTrt resin is in particular suitable for the preparation of C-terminal prolyl and cysteinyl peptides (please see 2-Chlorotrityl Chloride Resin-Linked Amino Acids). Release from this resin is achieved by using 1-50 % TFA in CH₂Cl₂ containing 8 % triisopropylsilane, AcOH/CF₃CH₂OH/CH₂Cl₂, 0.5 % TFA or hexafluoroisopropanol/CH₂Cl₂. ClTrt resin has been used in cyclization reactions under Heck reaction conditions, the solid phase synthesis of β-peptides via the Arndt-Eistert homologation of Fmoc-protected amino acid diazoketones and in Mannich reactions of alkynes, secondary amines and aldehydes in the presence of a copper (I) salt affording the corresponding aminomethylalkynyl adducts. 2-Chlorotrityl resin is highly suitable for the synthesis of peptide alcohols, e.g., peptaibols, and peptide ω-aminoalkylamides.

Image Unavailable-103006-332

Bovine Bactenecin

Catalog Number: (103006-332)
Supplier: Anaspec Inc
Description: Bactenecin is a 12-amino acid cationic antimicrobial peptide from bovine neutrophils.
Sequence:RLCRIVVIRVCR (Disulfide bridge: 3-11)
MW:1483.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-068

Human Ang II Peptide

Supplier: Anaspec Inc
Description: The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed by cleavage of Ang I by the angiotensin-converting enzyme (ACE) or chymases. Human heart chymase, a chymotrypsin-like serine proteinase, hydrolyzes the Phe8-His9 bond to yield the octapeptide hormone angiotensin II and His-Leu.
Sequence: DRVYIHPF
MW: 1046.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Image Unavailable-102997-478

EGFR Protein Tyrosine Kinase Substrate

Catalog Number: (102997-478)
Supplier: Anaspec Inc
Description: These peptides are potential substrates for EGFR protein tyrosine kinases. The fluorescent and biotinylated peptides are used to design assays for CaMKs.
Sequence:ADEYLIPQQ
MW:1076.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-336

[Ala13]-Apelin-13

Catalog Number: (103006-336)
Supplier: Anaspec Inc
Description: [Ala13]-Apelin-13 is an Apelin-13 antagonist evidenced from its blood pressure lowering reversal effects in hypertensive rats.
Sequence:QRPRLSHKGPMPA
MW:1474.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-308

Human;Pig Endothelin 1

Catalog Number: (102996-308)
Supplier: Anaspec Inc
Description: ET-1 is a potent vasoconstrictor peptide derived from endothelial cells. It plays a role in regulation of cardiovascular functions
Sequence:CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2492 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-064

Human Renin Substrate Peptide

Catalog Number: (102996-064)
Supplier: Anaspec Inc
Description: Renin acts on this sequence serving as its substrate yielding Angiotensin I and VIHN. It has implications in cardiovascular system.
Sequence:DRVYIHPFHLVIHN
MW:1760 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
785 - 800 of 9,421
no targeter for Bottom