You Searched For: Propagyl+bromide


587  results were found

SearchResultCount:"587"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103003-726)
Supplier: Anaspec Inc
Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103010-302)
Supplier: Anaspec Inc
Description: MMP-10 (stromelysin 2) cleaves extracellular matrix proteins, but is unable to cleave the triple-helical fibrillar collagens


Supplier: Peprotech
Description: TAFA proteins are a newly discovered family of proteins, which are distantly related to MIP-1α, a member of the CC-chemokine family. TAFA mRNAs are highly expressed in specific brain regions. The biological function of TAFA-2 is still unknown. Recombinant Human TAFA-2 is an 11.2 kDa protein consisting of 101 amino acid residues.

Catalog Number: (77125-802)
Supplier: Prosci
Description: MBD2 Peptide


Catalog Number: (89153-118)
Supplier: Enzo Life Sciences
Description: TLR9 inhibitor


Catalog Number: (76733-666)
Supplier: ANTIBODIES.COM LLC
Description: Human MBD3 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human MBD3 in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (89153-096)
Supplier: Enzo Life Sciences
Description: TLR9 ligand.


Catalog Number: (89153-094)
Supplier: Enzo Life Sciences
Description: TLR9 ligand.


Catalog Number: (CA89129-096)
Supplier: Cytiva
Description: MagRack 6 is a magnetic rack for small-scale protein purification and sample enrichment with magnetic beads. Each rack consists of anodized aluminium housing (blue), detachable plastic bar (white) containing a neodymium magnet.


Catalog Number: (76334-044)
Supplier: Biosensis
Description: MeCP2 antibody, Host: Rabbit, Reacts with human, mouse, rat, Isotype: IgG1, Immunogen: synthetic peptide (REEPVDSRTPVTERVS, aa 471-486) of C-terminus of human protein, Synonyms: MeCp-2 protein; Store lyophilised a


Catalog Number: (76334-020)
Supplier: Biosensis
Description: MeCP2 Monoclonal antibody, Clone: 4F11, Host: Mouse, Reacts with human, mouse, rat, Isotype: IgG1, Immunogen: Full-length recombinant human protein, Synonyms: MeCp-2 protein; MeCp2, Store lyophilised antibody at 2


Supplier: Anaspec Inc
Description: 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (89153-098)
Supplier: Enzo Life Sciences
Description: TLR9 ligand.


Catalog Number: (103005-902)
Supplier: Anaspec Inc
Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Sequence:GRPRTSSFAEG
MW:1164.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (89153-126)
Supplier: Enzo Life Sciences
Description: Inactive (neutral) control.


Catalog Number: (76761-062)
Supplier: Prosci
Description: Anti-MECP2 Rabbit Polyclonal Antibody


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
65 - 80 of 587
no targeter for Bottom