You Searched For: 1,4-Diethynylbenzene


16,913  results were found

Sort Results

List View Easy View
SearchResultCount:"16913"
Description: SLC1A7 antibody, polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Isotype: IgG, Immunogen: SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7, Applications:ELISA, IF, IHC, WB
Catalog Number: 10749-048
Supplier: Prosci


Description: Calumenin Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Lys20-Phe315, Fusion Tag: C-6 His tag, Purity: Greater than 95% (SDS-PAGE), Physical state: Lyophilized, Synonyms: IEF SSP 9302, CALU, Application: Biological assay, Size: 50 ug
Catalog Number: 75790-154
Supplier: Prosci


Description: Glutamine Synthetase Antibody Detects Microbial Gs. Glutamine Synthetase (Gs)Is An Enzyme That Plays An Essential Role In The Metabolism Of Nitrogen By Catalyzing The Condensation Of Glutamate And Ammonia To Form Glutamine: Glutamate + Atp + Nh3 Glutamine + Adp + Phosphate. Goat
Catalog Number: CARL200101238S
Supplier: Rockland Immunochemical


Description: Anti-SLC25A13 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, C-term-340 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10094-740
Supplier: Proteintech


Description: GCLC polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GCLC(7-24aa GSPLSWEETKRHADHVRR), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10209-754
Supplier: Boster Biological Technology


Description: DL-Pyroglutamic Acid, Purity: >99.0%(T), CAS No: 149-87-1, MF: C5H7NO3, MW: 129.12, Synonym: DL-Glutamic Acid Lactam, H-DL-Pyr-OH, 5-Oxopyrrolidine-2-carboxylic Acid, 2-Pyrrolidone-5-carboxylic Acid, Physical state: Solid, Form: Crystal- Powder, Colour: White, Size: 100G
Catalog Number: TCG0061-100G
Supplier: TCI America

Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-374
Supplier: Bioss


Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (KKLDQREYPGSETP) corresponding to the internal amino acids of GRIA4
Catalog Number: CAPIPA5-18931
Supplier: Thermo Scientific


Description: CRELD2 Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Ala25-Leu321, Fusion Tag: C-6 His tag, Purity: Greater than 95% (SDS-PAGE), Synonyms: Cysteine-Rich With EGF-Like Domain Protein 2, CRELD2, Application: Biological assay, Size: 50 ug
Catalog Number: 75790-070
Supplier: Prosci


Description: Polyclonal, Host: Rabbit, Species reactivity: human mouse rat , Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human GOT2. Purified by peptide affinity chromatography method. Application: ELISA Western blot 50ug
Catalog Number: 10102-784
Supplier: Prosci


Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-376
Supplier: Bioss


Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc


Description: 5G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-005G
Supplier: TCI America

SDS


Description: 1G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-001G
Supplier: TCI America

Catalog Number: 77438-046
Supplier: Bioss


Description: Anti-GAD2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Peptide, Peptide with Sequence CLRTLEDNEERMSRLSKVA, Format:Antigen affinity purification, Application: ELISA, WB, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10087-302
Supplier: Proteintech


145 - 160 of 16,913